KEGG   Sphingobacteriaceae bacterium GW460-11-11-14-LB5: CA265_05705Help
Entry
CA265_05705       CDS       T05546                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
sbx  Sphingobacteriaceae bacterium GW460-11-11-14-LB5
Pathway
sbx00040  Pentose and glucuronate interconversions
sbx00053  Ascorbate and aldarate metabolism
sbx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CA265_05705
   00053 Ascorbate and aldarate metabolism
    CA265_05705
Enzymes [BR:sbx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     CA265_05705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ARS39194
UniProt: A0A1X9Z2M2
Position
1386764..1388350
Genome map
AA seq 528 aa AA seqDB search
MNGQNIVASTYIEVNERSLKAVNPATGLTLDGDFFKASERLVDDALTSATLAFQSYRNLN
KDLKAAFLNAIADEIANLGEELVNRASAESGLPLGRLQGELGRTTGQLRLFANLVAEGSW
VDAIIDTALPERQPLPRPDIRRMLIPIGPVVVFGASNFPLAFSVAGGDTASALASGCPVV
VKAHPAHYGTSALVGGAIIKAAEKTGMPKGVFSLLYDDGYTIGAGLVQHPLTKAVTFTGS
FKGGMALINLAQQREQPIPVFAEMGSINPVIFLPKAIENQAEELAKKYAASITLGAGQFC
TNPGLLLAVQSPALESFKAALKEAISTIPSATMLTEGIASNYGKLSAEVVNEGGVALLSA
STVKNTELQNQSEAKIAQVSAADFIKNPKLREEIFGPYSLLVVAQDIAELEKAIDVLEGQ
LTVTLMAEKQELQGYQTLVNKLTDKTGRIILNGVPTGVEVCAAMQHGGPFPATNDSRFTS
VGSTAINRFARPLAYQDWEQELLPDELKDGNPLGIFRTINQKLTKSHE
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacaaaatattgtagccagtacctatatagaagttaatgaaagaagccttaaa
gctgttaatcccgcaacgggattaacgcttgatggtgatttttttaaagcaagcgagcgc
cttgttgatgatgccttaacatcagcaacattggctttccaaagctatagaaacctaaac
aaagaccttaaagctgcttttttaaatgccattgccgatgaaattgccaaccttggtgaa
gaactggtaaacagggcttcagcagaaagtggtttgccattaggccgtttacaaggagag
ttgggcaggactactggtcagttaaggttatttgccaatctggttgccgaaggctcctgg
gttgatgcaattattgacactgcactgcctgaaagacagcctttgccacgacctgatatt
aggcgaatgttaatcccaatcgggccggtagtggtttttggtgcgagtaattttccgctt
gctttttcagtggcaggtggcgataccgcatcggcactagcttcaggttgcccggtggtt
gttaaagcacaccctgcacattatggaaccagtgctttggtcggtggtgccattattaaa
gctgccgaaaaaacgggaatgcctaaaggggttttctctttattgtatgatgatggttat
acaatcggtgcgggtttggttcagcatcccttaactaaagcggtaacttttacaggttcg
tttaaaggaggaatggccttaattaatctggcgcaacagcgtgagcaacctattccggtt
tttgccgaaatgggaagcattaatccggtaatttttcttccaaaagccatcgaaaatcag
gcagaagagctggctaaaaaatatgctgcatcaattactttgggcgctggtcagttttgt
accaacccgggtttactgttagcggttcaatcaccggcattggaaagttttaaagccgct
ttaaaagaagctatttccactattccatcggcaaccatgcttaccgaaggtattgccagc
aattatggtaaactttctgctgaggtggtaaatgaaggtggcgttgcgcttttatcggca
tcgacagtgaaaaatactgaacttcaaaaccaatcagaggcgaaaattgcccaggtgagt
gcagccgattttatcaaaaatccaaaacttcgtgaggaaattttcggtccatattcactg
ctcgttgtcgctcaggatattgctgaacttgaaaaagccattgatgtgttggaaggacag
cttacggtaaccctaatggccgaaaaacaggagcttcagggctaccaaactttagtgaat
aagctgactgataaaacaggaagaattatcctaaatggggtgcctacaggtgtagaagtt
tgtgcggctatgcaacatggcggaccatttcctgcaactaacgatagccgttttacatcg
gttggttctactgcaatcaatcgttttgcaagaccattggcttatcaggattgggaacag
gaattattgccagatgaattgaaagatggaaatccattgggtattttcagaacgataaat
caaaaattaacgaaatctcatgagtaa

DBGET integrated database retrieval system