KEGG   Sphingobacteriaceae bacterium GW460-11-11-14-LB5: CA265_09310Help
Entry
CA265_09310       CDS       T05546                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
sbx  Sphingobacteriaceae bacterium GW460-11-11-14-LB5
Brite
KEGG Orthology (KO) [BR:sbx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbx03016]
    CA265_09310
Enzymes [BR:sbx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CA265_09310
Transfer RNA biogenesis [BR:sbx03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    CA265_09310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 UMPH-1 Arg_repressor
Motif
Other DBs
NCBI-ProteinID: ARS39835
UniProt: A0A1X9Z3Q6
Position
2315718..2316401
Genome map
AA seq 227 aa AA seqDB search
MLEIIYQDENLIAINKPHGLLVHQSSIARDATEFALQLLRDQVGKHVNPVHRLDRKTSGI
LLFAFDKTSEIAMHQQFMNTETNKKYLAILRGFTPDTMDIDYPLAKENGTMQDAFTSFRT
LQRAEVAVAFGKHPTSRYSLVEATPKTGRMHQLRRHFSHILHPIIGDRTHGCNKQNKFFK
EQWNMTTMLLHASELEFSHPITKERIHLKADLHDEFKRVMDFMKMER
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttggagattatttatcaggacgaaaacctaattgcaattaacaaaccccatgggtta
ttggttcatcaatcttcaattgcaagagatgcaactgagttcgcacttcaattactaaga
gaccaggttggcaagcacgtgaacccggtacacaggctggatcggaagacaagcggaatc
ttactattcgcttttgataaaacatcagaaattgctatgcatcagcaatttatgaatacc
gaaaccaacaaaaaatacctggccattcttcgtggtttcacacctgacactatggatatt
gattatcccttagctaaagaaaacggaacgatgcaggatgctttcacttcgtttagaacc
cttcaaagggcagaagtagccgtagcttttggtaaacatccaacctcacgttattcattg
gtagaggctacacctaaaaccgggaggatgcatcagttaagaaggcactttagccatatt
ttacatcccattattggcgataggacacatggctgtaacaaacagaacaaattctttaaa
gaacaatggaatatgaccaccatgctgcttcacgcttctgaactggaattttcccatccc
atcacaaaagaaagaatccacttaaaagcggacttacacgatgagtttaaaagagtgatg
gatttcatgaaaatggaacgctag

DBGET integrated database retrieval system