KEGG   Sphingobacteriaceae bacterium GW460-11-11-14-LB5: CA265_11600Help
Entry
CA265_11600       CDS       T05546                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sbx  Sphingobacteriaceae bacterium GW460-11-11-14-LB5
Pathway
sbx00010  Glycolysis / Gluconeogenesis
sbx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA265_11600
Enzymes [BR:sbx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     CA265_11600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like NIF EF-hand_11
Motif
Other DBs
NCBI-ProteinID: ARS40261
UniProt: A0A1X9Z5P6
Position
2877256..2877891
Genome map
AA seq 211 aa AA seqDB search
MQNIKNIIFDYGNVIFDIDFRIAQASFQKLGITDIENFFAHKAHNQLFDDFETGAISPAE
FRAGIRRAAGKPELTDQQIDEAWNSLLIGTIQENHDLLLEVKEKYRTFLLSNNNEIHYDW
IIDYLKATFQINNYDAYFEKAYFSQHMKLRKPNTNIFEQVLKENNLNPAETLFIDDSPQH
IEGAKKVGLNTLLMTEKPAQLGAFLKANGIL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacattaaaaacattattttcgattacggaaacgtaatatttgatatcgatttc
agaattgctcaggcatcttttcaaaaattgggcatcaccgatattgagaatttctttgcc
cataaagcacacaatcaattatttgatgattttgaaaccggggcaatttctcctgccgaa
tttagggctggaattagaagggcggcaggaaaacctgaattaaccgatcagcagattgat
gaggcatggaacagtttattaattggcaccattcaggaaaaccacgatttactgcttgaa
gtaaaagaaaaataccgtacttttttgttaagcaacaacaacgaaatccactacgactgg
atcattgattacctgaaagcaactttccagatcaataattacgatgcttattttgagaaa
gcttatttctctcagcacatgaaactgcgcaagcccaataccaatatttttgagcaggta
ttaaaagaaaacaatctaaacccggccgaaaccttatttatcgacgatagtccgcaacat
attgaaggtgctaaaaaagtgggtttaaataccctattgatgaccgaaaaacctgctcaa
ctgggggcctttttaaaagcaaatggaattttgtaa

DBGET integrated database retrieval system