KEGG   Sphingobacteriaceae bacterium GW460-11-11-14-LB5: CA265_23445Help
Entry
CA265_23445       CDS       T05546                                 

Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
sbx  Sphingobacteriaceae bacterium GW460-11-11-14-LB5
Pathway
sbx00670  One carbon pool by folate
sbx01100  Metabolic pathways
sbx01120  Microbial metabolism in diverse environments
sbx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CA265_23445
Enzymes [BR:sbx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CA265_23445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ARS42449
UniProt: A0A1X9ZBA5
Position
5735794..5736747
Genome map
AA seq 317 aa AA seqDB search
MKITDHIKNAKGKTLFSFELLPPVKGQSIQWIYDAIEPLLEFNPPFIDVTSLREDYIYKE
QANGLLQKVSYRKRPGTIAICAAIIHKYKVDAVPHLICGGFTKEETENALIDLQFLGIDN
VLALRGDARKADGNFVPTPGGHCYATDLIEHIKNHNEGKFLHEDVETFKSDFCIGVAGYP
EKHFEAPNMSTDFKYLKKKVEAGAEFIVTQMFFDNQKYFDFVKKCRENDINVPIIPGLKP
ISTLSQLNVLPKIFHIDLPDELTDALSHAKNNNEAKEIGTEAMIKQCKELIDFGAPVLHF
YTMGRPEQTKKIAKAIF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaagattacagaccatataaaaaacgcaaagggtaaaaccttattctcttttgaatta
ttaccgcctgtaaaaggacaaagcatacaatggatttatgatgcgattgaaccactattg
gagtttaatccaccttttattgatgtgacttcactccgtgaagattacatttataaagaa
caagccaacggtttgttacaaaaggtatcttatcgtaagcgtccgggtaccattgccatt
tgtgcggccattatccataaatataaagttgatgctgttccgcatttaatttgtggtggg
tttaccaaagaagaaaccgaaaatgcattgatcgatttacagtttttgggtattgataat
gtgctggccttacgaggcgatgcacgtaaggcagatggaaattttgttcctacaccaggc
gggcactgttatgctacagatctgattgagcacattaaaaaccataatgaaggtaaattt
ttgcacgaagatgttgaaacctttaaaagcgatttctgtattggcgttgccggttatcct
gaaaagcatttcgaggcacctaatatgagtaccgattttaaatacctgaaaaagaaggta
gaggcaggagctgaatttattgtaacgcagatgtttttcgataatcagaaatatttcgat
ttcgtaaagaaatgcagggaaaacgatatcaatgtaccgattataccaggattgaagccc
atcagtaccttgtcgcagttgaatgtgttgcctaagatttttcacatcgacttacctgat
gagttgaccgatgcgctatcgcatgctaaaaacaataacgaggcaaaagaaattggtacg
gaagcgatgattaaacaatgtaaagaactgattgattttggcgctccggtattacatttt
tatacgatgggtcgccctgagcagacgaaaaagattgcgaaggctattttttag

DBGET integrated database retrieval system