KEGG   Sphingobacteriaceae bacterium GW460-11-11-14-LB5: CA265_24715
Entry
CA265_24715       CDS       T05546                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyl transferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
sbx  Sphingobacteriaceae bacterium GW460-11-11-14-LB5
Pathway
sbx00061  Fatty acid biosynthesis
sbx00620  Pyruvate metabolism
sbx00640  Propanoate metabolism
sbx01100  Metabolic pathways
sbx01110  Biosynthesis of secondary metabolites
sbx01120  Microbial metabolism in diverse environments
sbx01200  Carbon metabolism
sbx01212  Fatty acid metabolism
Module
sbx_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sbx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CA265_24715
   00640 Propanoate metabolism
    CA265_24715
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CA265_24715
Enzymes [BR:sbx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     CA265_24715
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CA265_24715
SSDB
Motif
Pfam: ACCA Carboxyl_trans DUF1664 DUF1870
Other DBs
NCBI-ProteinID: ARS42690
UniProt: A0A1X9ZBN4
Position
6032988..6033950
AA seq 320 aa
MQQIKTSFDFEKPIADLVQQIEKVKQVAEKTKVDMSATLDELDGKLDETTNNLYKNLTGW
NKVQMSRHPDRPQTLDYINMICDDFIEMHGDRTVKDDKAIIGGFASINGQTVMVIGHQKG
KNTKERQFRNFGMANPEGYRKALRLMRLAEKFNKPVVSFIDTMGAYPGLEAEERGQGEAI
ARNLLEMSILRVPIICIVVGEGASGGALGIGIGDKVYMLEHTWYSVISPESCSSILWRSW
DFKEKAAECLKLTSDDMFGNKLIDGIIPEPLGGAHQDPELMGRTLKDYLVKDLAALGKLK
TDKLIEQRIEKFCAMGVVNE
NT seq 963 nt   +upstreamnt  +downstreamnt
atgcagcaaataaaaacatcattcgattttgaaaaacctattgccgatttagttcagcag
atagaaaaggttaagcaagttgccgaaaaaactaaggtagatatgtctgccacgttagac
gagcttgatggtaaattagatgaaactaccaataacttatataaaaatttaaccggttgg
aacaaggttcagatgagccgtcaccctgatcgcccgcaaacccttgattatatcaatatg
atctgtgatgattttattgaaatgcatggcgatagaacggttaaagatgataaggcaatt
attggcggttttgcttctataaatggtcaaacggtaatggttatcggtcaccagaaaggt
aaaaataccaaagagcgtcagtttcgcaatttcggtatggccaaccctgaaggttatcgt
aaagcattacgtttaatgcgcttggcagaaaaatttaataaaccggttgtttcttttatc
gatacgatgggtgcttaccctggtttagaggcagaagaacgcggacagggtgaggcgatt
gccagaaacttactggaaatgtctattctacgagtacccattatctgtatcgttgtaggc
gaaggtgcttccggaggtgctttaggtatcggtatcggcgataaggtttatatgttagaa
cacacttggtactcggtaatttctcctgaatcttgttcatctattttatggagaagctgg
gattttaaagagaaagctgctgaatgtttgaaattaacttctgatgatatgtttggcaac
aagctaatcgatggcattattccagaaccgcttggaggtgcacaccaggatccggagtta
atgggccgaactttaaaagattaccttgttaaagatttagcggcattgggtaaattaaaa
acggataaactgattgaacaaagaattgaaaaattctgtgcaatgggtgtagtaaacgaa
taa

DBGET integrated database retrieval system