KEGG   Salmonella bongori N268-08: A464_1056Help
Entry
A464_1056         CDS       T02733                                 

Definition
(GenBank) Glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00010  Glycolysis / Gluconeogenesis
sbz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A464_1056
Enzymes [BR:sbz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     A464_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AGR58242
UniProt: S5ND92
Position
1084384..1085619
Genome map
AA seq 411 aa AA seqDB search
MKKTLLAVAGAVLLSSAVQAQTTPEGYQLQQVLVMSRHNLRAPLANNGSILEQSTPNAWP
EWDVPGGQLTTKGGILEVYMGHYTREWLVAQGLIPSGECPAPGTVYAYANSLQRTVATAQ
FFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSATFRQQAVQAMEKARRQMHLDESYK
LLEQITRYQDSPSCKEKHQCSLIDAKDTFSADYQKEPGVQGPLKVGNSLVDAFTLQYYEG
FPLDQVAWGEIKTDRQWKVLSKLKNGYQDSLFTSPAVARNVAAPLVRYIDKALVVDRASA
SKMTVLVGHDSNIASLLTALDFKPYQLHDQYERTPIGGQIVFQRWHDRKANRELMKIEYV
YQSARQLRNAEVLTLRSPAQRVTLELKGCPVDANGFCPLDKFDAVMEAAAK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgttactcgctgtggctggggctgttttgttgtcatccgccgttcaggcg
cagacaacgccggagggctatcaattacaacaggtgctggtgatgagccgccacaacctg
cgggcgccactggcaaataatggcagtatactggagcagtcgacgccgaatgcctggccg
gagtgggacgttcccggcgggcaactgacgacgaaaggcggcatactggaagtctatatg
gggcactacacgcgtgaatggctggtggcgcaggggctgataccgtcgggagaatgtccg
gcgcccggtaccgtatatgcctatgcgaatagcttgcagcgcactgtggctaccgcgcaa
ttttttattaccggcgcttttcccggctgcgatattcctgttcatcatcaggaaaaaatg
ggtaccatggaccctaccttcaatccggtgatcaccgatgattccgccacgttcaggcaa
caggccgtacaggcgatggaaaaagcacgtcgtcagatgcaccttgatgagagttataaa
ctgcttgagcaaataacacgctatcaggattcgccatcctgcaaagagaagcatcaatgt
tcgctgattgacgcgaaagataccttcagtgcggactatcagaaggagcctggcgtgcaa
gggccgctaaaagtggggaactcgctggtggatgcgtttaccctacaatattacgaagga
tttccattggatcaggtcgcctggggcgagatcaagaccgatcggcagtggaaagtgctg
tcaaaactgaaaaacggctaccaggacagtctgtttacttcgccagccgtggcgcgcaac
gtcgcggcgccgctggtaaggtatattgataaggcgttagtcgttgatcgtgccagcgcg
tcgaagatgactgtcctggtaggccatgattccaatatcgcttcactgttgacggcgctg
gattttaaaccctatcaattgcatgaccagtatgagagaacgccaattggtgggcagata
gtctttcaacgctggcatgaccgtaaggctaaccgcgagttgatgaaaattgagtatgtc
tatcagagcgcccggcagctacgtaacgcggaagtgttaacgctcaggtcgcccgcgcaa
cgggtaacgctggagctgaaaggatgtccggtggatgcgaacggcttctgtccgcttgat
aaattcgatgccgtcatggaagcggcggcaaaatag

DBGET integrated database retrieval system