KEGG   Salmonella bongori N268-08: A464_1424
Entry
A464_1424         CDS       T02733                                 

Definition
(GenBank) Uncharacterized protein ImpA
  KO
K11902  type VI secretion system protein ImpA
Organism
sbz  Salmonella bongori N268-08
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbz02044]
    A464_1424
Secretion system [BR:sbz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A464_1424
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: AGR58610
UniProt: S5N7R5
Position
complement(1415188..1416111)
AA seq 307 aa
MEAIETLLTPVSPEHPCGESVRYSPEFDRLAAARQQDDETLPTGVWQSTPRRADWEEVAR
LACELTLSRSKDLVIMSWLGEAWLHLRGLVALPDALSLLALALERYPNELHPQIKDDDYD
YRAAPLCWVAQHYAAMVANAPLFTCEEETISLAQWQQGKRHDLPPPEMQANIGLALTASL
KWLQRLTDLCQNWPDATAPSFNVLEQKIKTCQQALGHSVTERPQSEAGETQISAATNSPA
FASREEAYQMLKQIADYLQRTEPHSPVPYLLHRACIWGHTPLPELLNELLVSDEAARQLW
RQLGVLP
NT seq 924 nt   +upstreamnt  +downstreamnt
atggaagctatagagacgctactgacgcctgtcagcccggagcatccttgtggagaatcg
gtacgctactcgccggaattcgaccggctggcggcggcgcggcaacaggatgatgaaact
ctgccgaccggcgtctggcaaagcacgccgcgacgcgccgattgggaagaggtcgcccgg
ctggcctgcgagttaacgctatcgcgcagtaaagatctggtgattatgagctggctgggg
gaagcctggttacacctgcgcggtctggtggcgctgcccgacgcgctgtccctgctggcg
ctggcgctggagcgctacccgaacgagctacatccacaaattaaggatgacgattacgat
tatcgcgctgccccactctgctgggtagcgcagcattatgccgcgatggttgctaacgcg
ccgctgtttacctgcgaggaggaaaccatctcgctggcgcaatggcaacagggaaaacgc
cacgatctccctccccctgaaatgcaggccaatattggtctggccctaacggcgagcctg
aagtggctgcagcgccttaccgatctttgccagaactggcctgacgcaaccgccccctct
ttcaatgtgctggagcagaaaattaaaacctgtcaacaggcgctgggacatagcgtcact
gaacgtccacagtcggaagccggagaaacgcaaatatctgcggcgacgaactcgccggca
ttcgccagccgtgaagaggcctaccagatgcttaaacagattgcggactacctgcagcgt
acggaaccccatagtccggtgccttatctgctacatcgcgcctgtatatggggacatacg
ccgttaccagagttacttaacgaattgctcgtcagcgatgaagccgcccgccagctctgg
cggcaactgggggtgttaccatga

DBGET integrated database retrieval system