KEGG   Salmonella bongori N268-08: A464_1430
Entry
A464_1430         CDS       T02733                                 

Definition
(GenBank) Uncharacterized protein ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
sbz  Salmonella bongori N268-08
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbz02044]
    A464_1430
Secretion system [BR:sbz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A464_1430
SSDB
Motif
Pfam: VipB VipB_2 TssC
Other DBs
NCBI-ProteinID: AGR58616
UniProt: S5MPH8
Position
1423103..1424584
AA seq 493 aa
MDNVQEHADTGGKTVTLSVLDRIIQEGRMARDELQQTYARDMLEELATQILDEGMSVDSD
TVAMINHRIAQIDELISAQLNDVLHHPDMQKLEASWRGLHQFVMNTETSTRLKLRLLNVS
RNELQTDLEKAVEFDQSTLFKKLYEDEYGTFGGNPYSVLVGDFEFGRHPQDVALLEKISQ
VAAAAHAPFIAAASPRLFDMGSFADLSVPRDLAKIFESAELMKWRAFRESEDSRYVSLVL
PHVLQRLPYGPDTVPVEGVNFVEDVDGLDASKYLWGNAAWALAGRITEAFALYGWCAAIR
GVEGGGLVENLPAHTFSTPSGDISLRCPTEVAITDRREKELNDLGFIALCHKKNSNTAAF
FGGQTTNQAKIYNTPEANANARISAMLPYILAASRFAHYLKVIMRDKVGSFMSRDEVESY
LNNWIADYVLLTDSAPQEIKARYPLREARVDVSEVPGKPGVYRAVVFLRPHFQLEELTTS
IRLVAELPPPAAA
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggataatgttcaggaacacgctgatactggcgggaaaacggttacgctgagcgtactg
gatcgcatcattcaggaaggccgcatggcgcgcgacgagctacagcagacctacgcacgc
gatatgctcgaagagttggcgacacagatcctggatgaagggatgtcggtggacagcgac
accgtggcgatgatcaatcatcgtatcgcgcaaattgatgagctgatcagcgcccagctc
aatgacgtgctgcatcaccctgatatgcagaaactggaagcctcatggcgcgggctgcac
cagtttgtgatgaatacggagaccagcacccgcctgaaactgcgcctgctgaacgtttcg
cgcaacgaactacagaccgatcttgagaaagctgtcgagtttgatcagagcacgctgttt
aagaagctgtatgaagatgagtatggcactttcggcggcaatccgtacagcgtactggtc
ggcgattttgagtttggccgccatccgcaggatgtggcgttgctggagaaaatctctcag
gtcgcagcggcggcccatgcgccttttatcgccgccgccagcccacggttatttgatatg
ggatcgtttgccgatttgagcgtaccgcgcgatttggcgaaaatttttgagagtgctgaa
ctgatgaagtggcgagcgttccgggaaagcgaagactcccgctacgtatcgctggtgctg
ccgcatgtgttgcagcgtttgccttatggcccggatacggtaccggttgaaggcgtcaac
tttgtcgaagatgtcgacgggctggatgcgagtaaatatctgtggggcaacgccgcgtgg
gcgctggcggggcggataacggaagcttttgctctgtatggctggtgcgcggcgattcgc
ggcgtggaagggggcggtctggtggaaaatctgccagcgcatacgttctccaccccttcc
ggtgacatcagcctgcgctgcccgacggaagtggcgattaccgaccggcgtgagaaagaa
cttaacgatctcggctttatcgccctgtgccacaagaaaaacagcaataccgccgccttc
tttggcggacagaccaccaatcaggcgaaaatctacaataccccggaagccaacgctaac
gcgcgtatttccgccatgttgccttatattcttgccgcctctcgctttgcgcactatctg
aaggtgatcatgcgtgacaaagtcggcagttttatgagccgtgatgaggtcgaaagctat
ctgaataactggattgccgattatgtgttgctgaccgacagcgcgccgcaggagatcaaa
gcgcgttatccgctgcgcgaggctcgcgttgatgtcagcgaagtgccgggcaaaccgggc
gtttatcgtgccgtcgtttttctgcgcccgcacttccagctagaagagttgaccacctcg
attcgtctggtcgctgaactgccgccgccggccgccgcctga

DBGET integrated database retrieval system