KEGG   Salmonella bongori N268-08: A464_1431
Entry
A464_1431         CDS       T02733                                 

Definition
(GenBank) Putative cytoplasmic protein USSDB7A
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A464_1431
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbz02044]
    A464_1431
Secretion system [BR:sbz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A464_1431
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AGR58617
UniProt: S5NEG0
Position
1424603..1425079
AA seq 158 aa
MDAIFLKLDDIKGECQVDGFKDQIEIMSYSHNVAMQVTNDVSNTERTSGRAHVGEMSLTK
FVDLSTPKLNEYCCGGKMIKEGTLTLCRNDDGKMLPFIVYTLTNVLISHLSVSGGSGGKP
VETMSLNFTKIKWEITAQKVGGQKEGNVSSLWDMAMNK
NT seq 477 nt   +upstreamnt  +downstreamnt
atggatgcgatttttttaaagctcgacgatatcaaaggtgaatgtcaggtcgatgggttt
aaagatcagatagaaattatgtcctacagccataacgtggcgatgcaggtcaccaacgac
gtcagtaataccgagcgcacttccggacgggcgcatgtgggggaaatgtcgctgaccaaa
tttgtcgatctttccacgccgaagcttaatgagtactgctgtggcggcaaaatgatcaaa
gaagggactctgacgctatgccgtaatgacgatggcaaaatgctgccgtttatcgtttat
accctgaccaacgtattgatctcgcatctgagcgtcagcggcggctccggcggtaagcca
gtcgaaacgatgtcactcaatttcaccaaaattaaatgggaaatcaccgcgcagaaggtg
ggggggcagaaagagggcaacgtctcatccctctgggatatggcgatgaataaataa

DBGET integrated database retrieval system