KEGG   Salmonella bongori N268-08: A464_1432
Entry
A464_1432         CDS       T02733                                 

Definition
(GenBank) putative cytoplasmic protein
  KO
K21637  anti-adapter protein IraD
Organism
sbz  Salmonella bongori N268-08
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    A464_1432
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AGR58618
UniProt: S5MVF8
Position
1425092..1425469
AA seq 125 aa
MQASIPVALFDRLLDEEISPGESVRRELVRLFNSRAPADADELPPLLAWGVPEWHGLNVG
DERVLDGYCRQLRAAILRCEPRIKTLSISVKDAYQQTLMLHLDAELRDETEPLSLLLVWQ
DGRWQ
NT seq 378 nt   +upstreamnt  +downstreamnt
atgcaagcctccattccggtcgcgctgtttgaccgactgctggatgaggagataagcccc
ggagagtcggtgcgccgggagttggttcgtcttttcaactcccgtgcgcccgcagatgct
gacgaattaccaccgctgctcgcctggggcgtgccggagtggcacggtctcaatgtgggc
gatgagcgggtgctcgacgggtactgccgtcagctacgcgcggcgattctgcgttgtgaa
ccgagaattaagacgctgagtatcagcgtgaaagatgcgtatcagcagacgctgatgctg
catctggacgctgaactacgcgacgagactgaaccgctgagcctgctactggtctggcaa
gacggtcgatggcaataa

DBGET integrated database retrieval system