KEGG   Salmonella bongori N268-08: A464_1437Help
Entry
A464_1437         CDS       T02733                                 

Definition
(GenBank) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A464_1437
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbz02044]
    A464_1437
Secretion system [BR:sbz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A464_1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C DUF3540 Sarcoglycan_1
Motif
Other DBs
NCBI-ProteinID: AGR58623
UniProt: S5MVG2
Position
1431825..1433789
Genome map
AA seq 654 aa AA seqDB search
MPDTTIIKLTAPNLTGLTVATAYTDSQLNTLTTATIAATTSAPLTLDASLATHLTATINN
ADYDALIAEARQLPATGNADRYQFVLRSWLWWLTLSSNNRVFQNLSAQEIVEKVFKDGGF
SDYKFQLKSKPAKREYCLQYNESDFNFISRLLEQEGIFWFFTYAEGKHTLVLADDNSAFP
PIPGEKKVKYQAAQSGARETGMIRSAQLRLQATAQGFQSSDFNYEQPKAALFSQAGEKKG
GMQYQHPGRFSVKAEGDALAAWKVNALKAQAKQLVGESDCPALMAGHWFTLTDHDDKSLN
IDWLITAVSHEYDGEHYRNRFTAIPKATPYRPLAVTPQPFMHTQTATVVGKSGEEIWTDK
LGRVKVQFPWDREGKSDETSSCWLRVATAWSGNGFGAQFIPRIGQEVVVSFIDGSPDKPL
ITGCVYNGANALPYALPANQTQSGIKTKSEKGFNELRFDDKKDAELLAMQAQKDFQLTVL
NDSKTTVSHDEIQSVKNDRTRIIEEGNETITLKKGNRTVKIEKGSDTLEVKDKRSVTVKG
DQEHAVDGNETHKVKGNYTLNVDGNLTIKVSGTLTLESSKTLNLKSGADLSASATSGLKL
DATNIASEAKASLTQKAATISHEAKATLTSKASATQTVDGGGMLIIKGGLVRIN
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacaccaccatcatcaaacttaccgccccgaatctaaccggccttaccgttgcg
accgcttacaccgattcccaacttaacaccctgaccaccgccaccattgccgcaaccacc
tccgcgccattaactctcgatgcctcactggcaacccatctaacagcaacgataaacaac
gccgactacgacgccctgattgccgaagcgcgccagcttccggcgaccggcaacgccgat
cgctatcagtttgtgctgcgctcgtggctgtggtggctgacgctctccagcaacaaccgt
gtgtttcagaacctcagcgcgcaggaaatcgtcgagaaagtatttaaagacggcggattt
agcgactacaaattccagctgaaaagcaaaccggcaaagcgtgaatactgcctgcaatat
aacgaaagtgattttaattttatttcgcggctgctggagcaggaggggattttctggttc
ttcacctatgcagaaggcaagcacacgctggtgctggcggatgataatagcgctttcccg
ccgatacctggcgagaaaaaagtaaaatatcaggcggcacagagcggcgcgcgggaaacc
gggatgattcgttcggcgcagctgcgtctgcaggccaccgcccagggctttcaaagcagc
gattttaactacgagcagccaaaagccgcgctgttttcgcaggcaggtgagaagaagggt
ggcatgcagtatcagcatccgggccgctttagcgtcaaagccgaaggcgacgcgctggcg
gcgtggaaggttaacgccctgaaggcgcaggcgaaacagctggtgggcgaaagcgactgc
ccggcgctgatggcggggcattggttcaccctgaccgatcacgacgacaaatctctgaat
atcgactggctaatcaccgccgttagccatgaatatgacggcgaacactatcgcaaccgc
tttaccgccatcccgaaggccacgccgtatcgcccgctcgccgtgacgccacagcccttt
atgcatacgcaaacggcgacggtggtgggtaaaagcggagaggagatttggaccgataaa
ctcgggcgggtgaaggtgcagttcccgtgggacagagagggcaaaagcgacgaaaccagc
tcctgctggctgcgggtcgccaccgcctggagcggtaacggtttcggcgcgcagtttatc
ccgcgcattggccaggaagtggtggtgagctttatcgacggcagcccggataaaccgctg
attaccggctgcgtctacaacggtgcgaatgcgctgccctatgcacttccggcgaaccag
acccagtcaggcattaaaaccaaaagtgaaaaaggcttcaacgaactacgcttcgacgat
aaaaaagatgccgagctgctggcgatgcaggcacaaaaagattttcagctcaccgtgctg
aacgacagtaaaaccacggtcagccatgacgagatccagagcgtcaaaaacgaccgcacc
cgcatcattgaagagggcaatgaaactattaccctgaaaaagggcaaccggacggtgaaa
atcgaaaaaggtagcgacacgctggaagtcaaagacaagcgtagcgtaacggtgaaaggc
gatcaggaacacgcggtggacggcaacgagacgcacaaggtgaagggcaactataccctc
aacgttgacggcaacctgacgatcaaggtcagcggcacgttgacgctggaaagcagtaaa
actctgaacctgaaaagcggggctgatcttagcgccagcgcgacgtcaggtctgaagctg
gacgccaccaacatcgccagcgaagcgaaagcgtcgctcacccagaaagcggccaccatc
agtcatgaagcgaaggccacgctcaccagcaaggccagcgccacccagacggtggacggc
ggcgggatgctgattatcaaaggcggactggtgaggattaactga

DBGET integrated database retrieval system