KEGG   Salmonella bongori N268-08: A464_2637Help
Entry
A464_2637         CDS       T02733                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00230  Purine metabolism
sbz00240  Pyrimidine metabolism
sbz01100  Metabolic pathways
sbz01110  Biosynthesis of secondary metabolites
sbz01130  Biosynthesis of antibiotics
Module
sbz_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sbz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
sbz_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
sbz_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A464_2637
   00240 Pyrimidine metabolism
    A464_2637
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbz04131]
    A464_2637
Enzymes [BR:sbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     A464_2637
Membrane trafficking [BR:sbz04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    A464_2637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AGR59822
UniProt: S5NHS0
Position
complement(2632734..2633165)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPNAVAKNVIGSIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF
DGLVEFMTSGPIVVSVLESENAVQRHRDLLGATNPANALAGTLRADYADSFTENGTHGSD
SLESAQREIAFFFGEGEVCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaacggactttttccatcattaaacctaacgcggtggcaaaaaacgttatt
ggcagtatctttgcgcgctttgaagcagcagggttcaaaattgttggtactaaaatgttg
cacctgaccgttgagcaggctcgcggcttctatgctgagcatgacggtaagccattcttt
gacggtctggtggagttcatgacctctggtcctatcgtggtatctgtgctggaaagtgaa
aatgcagtacagcgtcaccgcgatctgctcggcgctactaatccggcgaacgcactggcg
gggacgctgcgcgccgactacgctgacagcttcactgaaaacggtacccacggttcggat
tcgctggagtcggcgcaacgcgaaatcgcttttttctttggtgaaggcgaagtgtgcccg
cgcacccgttaa

DBGET integrated database retrieval system