KEGG   Salmonella bongori N268-08: A464_3037Help
Entry
A464_3037         CDS       T02733                                 

Definition
(GenBank) Acetyl-CoA acetyl transferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00071  Fatty acid degradation
sbz00280  Valine, leucine and isoleucine degradation
sbz00310  Lysine degradation
sbz00362  Benzoate degradation
sbz00380  Tryptophan metabolism
sbz00620  Pyruvate metabolism
sbz00630  Glyoxylate and dicarboxylate metabolism
sbz00640  Propanoate metabolism
sbz00650  Butanoate metabolism
sbz00900  Terpenoid backbone biosynthesis
sbz01100  Metabolic pathways
sbz01110  Biosynthesis of secondary metabolites
sbz01120  Microbial metabolism in diverse environments
sbz01130  Biosynthesis of antibiotics
sbz01200  Carbon metabolism
sbz01212  Fatty acid metabolism
sbz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A464_3037
   00630 Glyoxylate and dicarboxylate metabolism
    A464_3037
   00640 Propanoate metabolism
    A464_3037
   00650 Butanoate metabolism
    A464_3037
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A464_3037
   00072 Synthesis and degradation of ketone bodies
    A464_3037
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A464_3037
   00310 Lysine degradation
    A464_3037
   00380 Tryptophan metabolism
    A464_3037
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A464_3037
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A464_3037
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A464_3037
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbz04147]
    A464_3037
Enzymes [BR:sbz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A464_3037
Exosome [BR:sbz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A464_3037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGR60221
UniProt: S5MTZ2
Position
complement(3030284..3031492)
Genome map
AA seq 402 aa AA seqDB search
MAVSFCAEVVMKEVVIVAALRTPIGCFQGTLARHSAVELGSMVVKALIERSGVDVNAIDE
VILGQVLTAGAGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADIV
IAGGQENMSRAPHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGI
SRELQDAWALSSQQKARAAIDTGRFKDEIVPVITQRNGQIAIVDTDEQPRADTSAEGLAQ
LHPAFDSFGSVTAGNASSINDGAAAVMMMSEAKAMELGLPILARIRAFASVGVDPALMGI
APVYATRRCLERAGWQLADVDLIEANEAFAAQAISVGKMLEWDERRVNVNGGAIALGHPI
GASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTVERD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcattttgcgctgaggtggtaatgaaagaggttgtgattgtggcggcactg
cggacgcccatcggctgttttcagggaacgctggcccgtcattccgccgtcgagctgggg
agcatggtcgtaaaagcgttgattgagcgcagtggcgtggatgttaatgctatcgatgag
gtcatccttggtcaggtgctgaccgccggcgccgggcagaacccggcacgccagtccgct
atcaagggggggctgcctaataccgtttccgctattaccattaatgacgtttgtggttcc
ggtttaaaagcattgcaccttgcgacgcaggctattcagtgcggtgaggcagacattgtt
atcgcgggtgggcaggaaaatatgagccgtgcgccgcatgtcctcaatgacagccgtact
ggcgcgctacctgatgctgacaatctggtggatagcctggtacatgacggcttatgggac
gcttttaacgattatcacattggcgtaacggcagaaaatctggcgcgggaatatggtatc
agccgtgaattacaggatgcctgggcgctcagttcgcagcaaaaggccagggcggcgatc
gataccggacgttttaaagatgagattgtccctgtcatcacgcagcgtaacgggcagatc
gcgattgtcgataccgatgaacaaccgcgcgctgacaccagtgcggaagggttagctcaa
ttgcatccggcatttgatagttttggttcggtaacggcgggtaatgcctcatcaattaat
gacggcgccgccgccgtgatgatgatgagcgaggcgaaagccatggaattggggttaccg
atactggcgcgcatccgcgcgtttgccagtgtcggcgtcgatccggcgctgatgggtatt
gctccggtatatgccacccggcgttgcctggagcgggcaggatggcaactggcggatgtt
gatcttattgaagccaacgaagcgtttgccgcccaggcgatatcggtcggaaaaatgctg
gaatgggatgagcgacgggtgaatgttaacggcggtgcaatagccttggggcatcccatt
ggtgcttccggttgccgaattcttgtttcactggtgcatgaaatggttaaacgcgatgcg
cgaaaagggctggcaacgctttgtatcggcggtggtcagggcgtcgctttaacggttgag
cgtgactga

DBGET integrated database retrieval system