KEGG   Salmonella bongori N268-08: A464_642Help
Entry
A464_642          CDS       T02733                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00520  Amino sugar and nucleotide sugar metabolism
sbz01100  Metabolic pathways
sbz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A464_642
Enzymes [BR:sbz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     A464_642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AGR57828
UniProt: S5MTA3
Position
complement(647343..648497)
Genome map
AA seq 384 aa AA seqDB search
MYALTQSRIYTGYEILDDHALIVANGLIDRVCPMAELPPGMEQRSLNGAILSPGFIDVQL
NGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNFLPTLITTSDDLMKQGIRVMREYLQK
HPNQALGLHLEGPWLNLVKKGTHNPDFVRKPDAALVDLLCDNADVITKVTLAPEMVPADV
IAKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLFNAMPYITGREPGLAGAILDEAD
IYCGVIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIDQFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVAHCGIALDEVLRMATLYPARAIGVDKHLGSIAPGKVANL
TAFTHDFKIIKTIVNGDEVVDVSK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtatgctttaacccagagccggatctataccggttacgaaattcttgatgaccatgcg
cttattgtcgctaatggcctgattgaccgcgtttgtccgatggctgaactgccgccggga
atggaacaacgctcactgaatggagccattctctcccccgggtttattgatgtgcagcta
aatggctgcggcggcgttcagtttaacgatactgcagaagctgtcagcgttgaaacgctg
gaaattatgcagaaagccaatgagaaatcgggctgtactaacttcctgccaacgctcatc
accaccagcgatgacctgatgaagcagggtattcgtgtcatgcgtgagtacctgcaaaaa
catccgaatcaggcgctgggccttcacctggaaggtccctggctcaatctggtaaaaaaa
ggtacccataatcctgatttcgtacgtaaaccagacgctgcgctggtcgatctcttgtgc
gataatgctgacgtcatcaccaaagtcactctcgcgccggaaatggttcctgctgacgtg
atcgctaaactggcgaatgcaggcattgtggtttccgcaggtcactccaacgcgacgtta
aaagaggcaaaagcgggcttccgcgccgggattacctttgcaactcacctgtttaacgcg
atgccgtatattacagggcgtgagccgggtctggctggcgctatcctggatgaagcggat
atttattgcggcgttatcgccgatggtctgcatgtcgactatgccaatattcgcaatgcc
aagcgcctgaaaggcgacaaactttgtctggtgacagatgccaccgcaccggcgggagct
aacattgatcagttcattttcgctggtaaaacaatatactaccgcaatggactgtgtgtg
gatgaaaacggtacgctgagcggctcgtccttaaccatgattgaaggcgtacgtaacctg
gtcgcgcattgcggcatcgctctggatgaagtgctgcgtatggcgacgctctacccggct
cgcgctatcggcgttgacaagcatcttggtagcatcgcgccagggaaagtagcaaacctg
accgcattcacccacgactttaaaattatcaagactatcgttaatggtgacgaggtcgtt
gacgtgagtaagtga

DBGET integrated database retrieval system