KEGG   Salmonella bongori N268-08: A464_79Help
Entry
A464_79           CDS       T02733                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
sbz  Salmonella bongori N268-08
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A464_79
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AGR57265
UniProt: S5N4D2
Position
complement(82123..82500)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDENGDAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgcccagagtgtgtattcaggtacaaagcgtctatattgaggcgcaatcc
tcacctgacgatgaacgttacgtttttgcctataccgtgaccatccgcaatctgggccgg
gcgccagttcagctattaggccgttactggctgattaccaatggtcatggccgtgagaca
gaagtccagggcgaaggggtggttggcgtccagccgcgcattgcgccaggcgaagagtat
cagtataccagcggcgctgtgattgaaacgccgctgggcaccatgcagggtcattacgaa
atgatcgatgaaaatggcgacgcctttaccatcgacatccccgtgtttcgactcgccgtc
cctacacttattcactaa

DBGET integrated database retrieval system