KEGG   Staphylococcus carnosus subsp. carnosus: SCA_0471
Entry
SCA_0471          CDS       T00863                                 
Name
(GenBank) conserved hypothetical phage protein
Organism
sca  Staphylococcus carnosus subsp. carnosus
SSDB
Motif
Pfam: LacI MarR
Other DBs
NCBI-ProteinID: CAL27385
UniProt: B9DJG7
Position
479588..479824
AA seq 78 aa
MIINYLTIKDIQMLAGVSKSKASSIVRELNSELEEEGFIAIRGKVPIQLVREKFPYCDLS
DEAIRELKEFNVKKEVKQ
NT seq 237 nt   +upstreamnt  +downstreamnt
atgatcatcaattatttaactataaaagatatacagatgttggcaggtgttagtaaaagt
aaagcatcttcaattgtaagggagttgaacagtgaacttgaagaagaaggatttattgca
attagagggaaggttcctatccaattagtgagagaaaaattcccatattgtgatttgtcg
gatgaagcaattcgagaattaaaagaatttaacgttaaaaaagaggtgaaacaatga

DBGET integrated database retrieval system