KEGG   Staphylococcus carnosus: SCA_1300Help
Entry
SCA_1300          CDS       T00863                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sca  Staphylococcus carnosus
Pathway
sca00020  Citrate cycle (TCA cycle)
sca00480  Glutathione metabolism
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01120  Microbial metabolism in diverse environments
sca01130  Biosynthesis of antibiotics
sca01200  Carbon metabolism
sca01210  2-Oxocarboxylic acid metabolism
sca01230  Biosynthesis of amino acids
Module
sca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sca_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCA_1300 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SCA_1300 (icd)
Enzymes [BR:sca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SCA_1300 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CAL28205
UniProt: B9DNB5
Position
complement(1309377..1310642)
Genome map
AA seq 421 aa AA seqDB search
MAPEKIVKQEDGLLVPNNPIIPFIIGDGIGPDIWRASRRVLDAAVEKAYNGEKQIEWKEI
LAGQKAYDTTGEWLPQETLDAIEEYLIAIKGPLTTPIGGGIRSLNVALRQTLDLFACLRP
VRWFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEFKEGTPEAEKLIKFLQDEMGATNIRF
PETSGIGVKPVSKEGTERLVRSAIQYAIDNDRKSVTLVHKGNIMKFTEGAFKQWGYDLAE
NEFGDKVFTWQQYDRLVDEKGKDEANKIQDQAVADGKIIIKDSIADIFLQQILTRPAEYD
VVATMNLNGDYISDALAAQVGGIGIAPGANINYDTGHAIFEATHGTAPKYADLDKVNPSS
ELLSAVLMLEHLGWQEAADLITASIEKTIASKVVTYDFARMMDGATEVKTSEFADELIKN
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcaccagaaaaaattgttaaacaagaagacggtttattagtaccaaacaacccaatt
atcccattcattatcggagacggaattggaccagatatctggagagcatcacgtcgtgtt
ttagatgctgctgtagaaaaagcttataatggtgaaaagcaaattgaatggaaagaaatt
ctagcaggtcaaaaagcgtacgatactactggagaatggttaccacaagaaacacttgat
gcaattgaagaatatttaattgctatcaaaggacctcttactacaccaatcggtggcggt
atccgttcattaaacgtagctttacgtcaaacattagatttgtttgcttgcttacgtcct
gtacgttggttcaaaggtgtaccatcaccagttaaacgtccagaagatactgatatggtt
attttccgtgaaaatactgaagatatttatgcaggtatcgaatttaaagaaggtactccg
gaagctgagaaattaatcaaattcttacaagatgaaatgggtgcaacaaatatccgtttc
cctgaaacttctggtattggtgttaaaccagtatctaaagaaggtacagaacgtttagtt
cgttcagctatccaatatgcaatcgataacgatcgtaaatctgtaactctagtacacaaa
ggtaatatcatgaaatttactgaaggtgctttcaaacaatggggttatgatttagctgaa
aatgaatttggagataaagtattcacttggcaacaatatgatcgtttagttgatgaaaaa
ggtaaagacgaagcaaacaaaattcaagatcaagcagttgcagacggtaaaattatcatt
aaagattctatcgctgacatcttcttgcaacaaattttaactcgtccagctgaatacgat
gtagtagcaactatgaacttaaatggtgactatatctctgatgcattagctgcacaagtt
ggcggcatcggtattgcaccaggtgcaaacattaactatgacactggccatgctatcttt
gaagcaactcacggtacagcacctaaatatgcagatttagataaagtaaacccttcatct
gaattattaagtgcagtattaatgttagaacacttaggttggcaagaagctgcagattta
attacagcttcaattgaaaaaacaatcgcttctaaagttgtaacttacgactttgcacgt
atgatggatggcgctactgaagttaaaacatcagaattcgctgatgaattgattaaaaat
ctgtaa

DBGET integrated database retrieval system