KEGG   Staphylococcus carnosus: SCA_2088Help
Entry
SCA_2088          CDS       T00863                                 

Gene name
vraB
Definition
(GenBank) putative acetyl-CoA c-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sca  Staphylococcus carnosus
Pathway
sca00071  Fatty acid degradation
sca00072  Synthesis and degradation of ketone bodies
sca00280  Valine, leucine and isoleucine degradation
sca00310  Lysine degradation
sca00362  Benzoate degradation
sca00380  Tryptophan metabolism
sca00620  Pyruvate metabolism
sca00630  Glyoxylate and dicarboxylate metabolism
sca00640  Propanoate metabolism
sca00650  Butanoate metabolism
sca00900  Terpenoid backbone biosynthesis
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01120  Microbial metabolism in diverse environments
sca01130  Biosynthesis of antibiotics
sca01200  Carbon metabolism
sca01212  Fatty acid metabolism
sca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCA_2088 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SCA_2088 (vraB)
   00640 Propanoate metabolism
    SCA_2088 (vraB)
   00650 Butanoate metabolism
    SCA_2088 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCA_2088 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SCA_2088 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCA_2088 (vraB)
   00310 Lysine degradation
    SCA_2088 (vraB)
   00380 Tryptophan metabolism
    SCA_2088 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCA_2088 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCA_2088 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCA_2088 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sca04147]
    SCA_2088 (vraB)
Enzymes [BR:sca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SCA_2088 (vraB)
Exosome [BR:sca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCA_2088 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAL28993
UniProt: B9DKE5
Position
complement(2099844..2100992)
Genome map
AA seq 382 aa AA seqDB search
MQEAMIIEAKRTPIGRYGGALKHLEPEDLLKPLIHELTDLHEDIPSHIDDVIIGNTVGNG
GNIARKSLLHAGLPQQIPGMTVDRQCGSGLEAINLACRLIQSRAGSIYLAGGVESVSRAP
WKIQKPQSLYEKQPPEIYERAPFTPTEYGDPSMLEAAENVAQMYQISRERQDDWAARSHN
LYHQYQSEIVREITPLKVHGEMLEVDESPKQNITAERLGRLKPVFPEGTVTVGNACPKSD
GASLVLVMSETKAKELGLIPKLRFVDSEVAGVNPKVLGIGPVPAAERTLERQGWSVSDLD
WTAFNEAFSSQVLASIDLLSLQEAKVNPYGGALAEGHPYGASGANLVARLVTIQKYHLGN
KLMAAIGIGGGMGIASLFESVK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagctatgattattgaagcaaaacggacaccaattggacgttatggaggagca
ttgaaacatcttgaacctgaagatttgttgaaacctttgattcatgaattgactgatttg
catgaggatattccatcgcatatagatgatgtcattatcggaaatacagttggtaatggc
gggaatattgctcgtaaatctttattgcatgctggtttaccgcaacaaattcctggaatg
acagtggatcgtcaatgcggctctggtttagaagcaatcaacttggcgtgtcgtttaatt
cagagcagagctggcagtatttatcttgcgggtggtgtagagtctgtaagtcgtgcacca
tggaaaatacagaaaccgcaatcattatatgaaaaacaaccgccagagatatatgaacgt
gcaccttttacaccaacagaatatggagatccaagtatgttagaagcagcagaaaacgtg
gcacagatgtatcaaatttctcgtgaaagacaggatgactgggcagcgcggagtcacaat
ttatatcatcaataccaaagtgagattgttcgtgaaattacaccgttaaaagtacatggg
gaaatgctggaagttgatgaatcaccgaaacaaaatataacagcagaacgtttaggacga
cttaaacctgtatttccagaaggcactgtaactgtagggaatgcttgtcctaagagtgat
ggagcatcgcttgtcttagttatgtctgaaacaaaagcaaaagagctgggattaataccg
aaattgcgttttgtagatagtgaagtagctggagtgaatcctaaagtattaggtatcgga
cctgttcctgccgccgaacgtactttagagcgacaaggttggtctgtatcggatttagat
tggactgcattcaatgaagcttttagttctcaagtgctcgcatctatcgatttgttaagc
ttgcaagaagcaaaagtgaacccttatggcggtgcattagcagaaggacatccatatggt
gcgagcggcgcaaatcttgtagcacgcttagttacaattcaaaaatatcacctaggaaat
aaattaatggctgctatcggtatcggaggcggtatgggtatagccagcttgtttgaaagt
gtgaaatag

DBGET integrated database retrieval system