KEGG   Staphylococcus carnosus: SCA_0426Help
Entry
SCA_0426          CDS       T00863                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sca  Staphylococcus carnosus
Pathway
sca00010  Glycolysis / Gluconeogenesis
sca00051  Fructose and mannose metabolism
sca00562  Inositol phosphate metabolism
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01120  Microbial metabolism in diverse environments
sca01130  Biosynthesis of antibiotics
sca01200  Carbon metabolism
sca01230  Biosynthesis of amino acids
Module
sca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sca_M00002  Glycolysis, core module involving three-carbon compounds
sca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCA_0426 (tpiA)
   00051 Fructose and mannose metabolism
    SCA_0426 (tpiA)
   00562 Inositol phosphate metabolism
    SCA_0426 (tpiA)
Enzymes [BR:sca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCA_0426 (tpiA)
Exosome [BR:sca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCA_0426 (tpiA)
  Exosomal proteins of bladder cancer cells
   SCA_0426 (tpiA)
  Exosomal proteins of melanoma cells
   SCA_0426 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Plant_all_beta QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAL27340
UniProt: B9DJJ7
Position
440977..441738
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTVQEAKDFVNELPQLPDTNEVEAVICAPTIQLDALITLVKEGKAEG
LEIGAENTYYEESGAFTGETSPVALADLGVKYVIIGHSERRELFHETDEDVNKKVHAVFK
HGMTPIICVGETNEQRESGKAEEVVSDQVKKALAGLSDEQLKQVVIAYEPIWAIGTGKSS
TAKDANEMSAFIRKTVAELSNQEVADAVRIQYGGSVKPNNIAEYMAESDIDGALVGGASL
KVEDYVKLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattattgcaggtaactggaaaatgaataaaactgtacaagaggctaaa
gactttgtaaacgaattacctcaattaccagatacaaatgaagtagaagccgttatttgt
gcaccaactattcaattagatgcattaattactttagtaaaagaaggtaaagcagaagga
cttgaaattggtgctgaaaacacttattacgaagaaagcggcgcatttactggtgaaaca
tctccagttgcattagcagatttaggtgttaaatatgtaattatcggccattctgaacgt
cgtgaattgttccacgaaactgatgaagatgttaataaaaaagtccacgctgtgtttaaa
cacggtatgactccaatcatctgtgttggtgaaacaaatgaacaacgtgaaagcggaaaa
gctgaagaagttgtatcagatcaagttaaaaaagcattagcaggtttatctgacgaacaa
ttaaaacaagtagttatcgcttacgaacctatttgggcaattggtactggtaaatcttct
acagctaaagatgctaatgaaatgagcgcatttatccgcaaaacagttgctgaactttca
aaccaagaagtagcagatgcagttcgtattcaatacggcggcagtgtaaaacctaataat
atcgctgaatatatggcagaatcagatattgatggtgctttagtcggcggtgcttcattg
aaagtagaagactatgtaaaattattagaaggtgctaaataa

DBGET integrated database retrieval system