KEGG   Staphylococcus carnosus: SCA_0431Help
Entry
SCA_0431          CDS       T00863                                 

Gene name
est
Definition
(GenBank) carboxylesterase precursor
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
sca  Staphylococcus carnosus
Brite
Enzymes [BR:sca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SCA_0431 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S9 DLH Abhydrolase_6 BAAT_C DUF2048 Abhydrolase_3 DUF4611 Chlorophyllase2 Chlorophyllase
Motif
Other DBs
NCBI-ProteinID: CAL27345
UniProt: B9DJK2
Position
445733..446473
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LQSSPHVWFKDALDGYDFLVEHGYDEIVVAGLSLGGDFALKLSLNRDVEGIVTMCAPMFI
KTEGSMYEGVLEYARNFKKYQGKDEATINREMEAFHPTHTLKELQQTIQGVRDHVDEVMD
PLLVIQAEQDKMINPESANVIYDEASSEDKNIKWYADSGHVITIDKEKEKVFEDIYEFLE
SLDWPE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcagattaaattgccaaagccgttcttttttgaagaaggaaaaagagcagtattattg
ttacatggttttactggaaactcttccgatgtaagacaactcgggcgctttttacagaaa
aaaggttacacatcttatgcgcctcaatatgaaggccatgcagcgccaccggaagaaatt
ttgcaatccagcccgcatgtctggtttaaagatgcgttagatggttacgactttttagtg
gaacatggatatgatgaaattgtggtagccggcttatctttaggtggagattttgccctt
aagttaagcttaaatagagatgtagagggtattgtaacgatgtgtgcgcctatgtttatt
aagacagaaggctcaatgtatgaaggcgttcttgaatatgcgcgcaactttaaaaaatac
caagggaaagatgaggcgacaatcaatcgcgagatggaagctttccatccgactcatact
ttaaaagaattacagcaaacaatacaaggtgttcgagatcacgtagatgaagtgatggat
ccattacttgtcattcaagcagaacaagacaaaatgattaatcctgaatctgcaaatgtg
atttatgatgaagcatcttctgaagacaaaaatataaaatggtatgcggattccggtcat
gttattacaattgataaagaaaaagaaaaagttttcgaggatatttacgagttccttgaa
agtcttgattggcctgaatag

DBGET integrated database retrieval system