KEGG   Staphylococcus carnosus: SCA_1018Help
Entry
SCA_1018          CDS       T00863                                 

Gene name
trpA
Definition
(GenBank) putative tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sca  Staphylococcus carnosus
Pathway
sca00260  Glycine, serine and threonine metabolism
sca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01130  Biosynthesis of antibiotics
sca01230  Biosynthesis of amino acids
Module
sca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCA_1018 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCA_1018 (trpA)
Enzymes [BR:sca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCA_1018 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth Ferrochelatase IGPS
Motif
Other DBs
NCBI-ProteinID: CAL27926
UniProt: B9DP27
Position
1034560..1035312
Genome map
AA seq 250 aa AA seqDB search
MSKLFIPYIMGNKDFISNLKVLSDEGADIVEIGLPFSDPVADGPTIMEAGNKAIEEGMNA
RKILQELKAHKDELKDTKYVLMTYYNIILHYGEEQFIKDCEAAGVYGLIIPDLPFELGEQ
LKERFKDSSVKIISLIAMTASDDRIQKIAQHADGFIYTVTMNATTGENGQFHPELQSKIE
YIQKNADVPVVAGFGIRNPEQVSTLSEFTDGIVIGSEIVKRFANDSETSIRQYLQSIRRA
LDETKAAANS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattattcattccttatatcatgggcaataaagattttatttctaatttaaaa
gtactaagtgatgaaggtgcagacattgtagaaattggtttgccattctctgatccagtt
gctgacggaccaacgattatggaagcaggcaataaagcgattgaagaaggtatgaatgca
cgcaaaattttacaagagttgaaagcacataaagatgaattgaaggatacaaaatatgta
ttaatgacatattacaatattatcttgcactatggtgaagaacaattcatcaaagattgt
gaagcagctggcgtgtatggtttaattattcctgatttaccatttgaattaggagagcag
ttgaaagaacgttttaaagacagcagtgtcaaaatcatttcattgattgcaatgaccgct
tctgatgaccgtattcaaaagattgcacaacatgctgatggtttcatttacacagttaca
atgaatgcaacaactggagaaaatggccagttccacccagaactgcaaagtaaaattgag
tacattcaaaaaaatgcagatgttcctgtcgtagctggattcggaatcagaaatccagaa
caagtatcgacactatctgaatttacagatggcatcgtcatcggtagtgaaattgtaaaa
cgttttgccaatgatagcgaaacgtcaatcagacaatacttgcaaagtattcgtcgtgca
ttggatgaaacaaaagcagcagcaaactcataa

DBGET integrated database retrieval system