KEGG   Staphylococcus carnosus: SCA_1057Help
Entry
SCA_1057          CDS       T00863                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sca  Staphylococcus carnosus
Pathway
sca00020  Citrate cycle (TCA cycle)
sca00310  Lysine degradation
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01120  Microbial metabolism in diverse environments
sca01130  Biosynthesis of antibiotics
sca01200  Carbon metabolism
Module
sca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCA_1057 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    SCA_1057 (odhB)
Enzymes [BR:sca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCA_1057 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: CAL27965
UniProt: B9DNZ2
Position
complement(1074306..1075583)
Genome map
AA seq 425 aa AA seqDB search
MSEIIVPELAESITEGTIAEWLKNPGDSVDKGEAVVELETDKVNVEVVSEEAGMIQELLA
EAGDTVEVGQAIATVGEGSGSPSQSSSEDKKEDTSSKEDTSKSEEKSQPAASETSSKEES
SSNSDQRVNATPSARKYAREKGIDLSEVEAKNSDVVRKNDIDRKQQGGQSNQGSQAAKSE
APAKKQNQEPSKPVVREKMSRRKQTAAKKLLEVSNNTAMLTTFNEVDMANVMNLRKRKKE
QFIKDHDGTKLGFMSFFTKAAVAALKKYPAVNAEIDGDEMVTKQFYDIGIAVSTDNGLIV
PFVRDCDKKNFAEIESSIADLAVKARDNKLSLGDLMNGSFTITNGGIFGSMMSTPIINGS
QAAILGMHSIITRPIAIDKDTIENRPMMYLALSYDHRIIDGKEAVGFLKTIKDLIENPED
LLLES
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagattatagttccagagttagcagaatctattacggaaggtacaattgctgag
tggttaaaaaatccaggtgactcagtagataaaggtgaagcagttgttgaattagaaact
gacaaagtaaatgttgaggtcgtttctgaagaagcaggtatgattcaagaattattagca
gaagctggagatacagtagaagttgggcaagcaattgcaacagttggggaaggcagcgga
agcccatcacaatcatcttctgaagataaaaaagaagacacttcttctaaagaagatact
tcaaaatcagaagaaaaatcacaaccagcagcatctgaaacttcttctaaagaagaaagc
agttcaaatagcgatcaacgcgtaaatgcaacaccttcagcacgcaaatatgcacgtgaa
aaaggtattgatttaagcgaagttgaagctaaaaactctgatgttgttcgtaaaaatgat
attgatcgcaagcaacaaggcggacaatcaaaccaaggtagccaagctgctaaatcagaa
gcacctgctaaaaaacaaaatcaagaaccttcaaaaccagttgtacgtgaaaaaatgtca
cgtcgtaagcaaacagcagctaaaaaattattagaagtatctaataacactgcaatgctt
acaacattcaatgaagtagatatggcaaatgttatgaatttacgtaaacgtaaaaaagaa
caattcatcaaagaccacgatggaacaaaattaggtttcatgtcattcttcactaaagca
gcagttgcagcattgaaaaaataccctgcagttaatgctgaaattgatggagacgaaatg
gttactaaacaattctatgatattggtattgctgtatctactgataatggattaattgta
ccgttcgtacgtgactgtgataagaaaaactttgctgaaattgaaagctcaatcgcagac
ttagctgttaaagcacgtgataataaattatcacttggtgatttaatgaatggttcattc
acaattacaaatggtggtattttcggttcaatgatgtctactccaatcattaacggaagc
caagctgctattttaggaatgcattcaatcatcactcgtccaatcgctatcgataaagac
actattgaaaaccgtccaatgatgtacttagcattaagctatgaccacagaattatcgac
ggcaaagaagcagttggattcttgaaaacaattaaagatcttattgaaaatccagaagat
ttactattagaatcttaa

DBGET integrated database retrieval system