KEGG   Staphylococcus carnosus: SCA_1964Help
Entry
SCA_1964          CDS       T00863                                 

Gene name
fbp
Definition
(GenBank) putative fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sca  Staphylococcus carnosus
Pathway
sca00010  Glycolysis / Gluconeogenesis
sca00030  Pentose phosphate pathway
sca00051  Fructose and mannose metabolism
sca00680  Methane metabolism
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01120  Microbial metabolism in diverse environments
sca01130  Biosynthesis of antibiotics
sca01200  Carbon metabolism
Module
sca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCA_1964 (fbp)
   00030 Pentose phosphate pathway
    SCA_1964 (fbp)
   00051 Fructose and mannose metabolism
    SCA_1964 (fbp)
  Energy metabolism
   00680 Methane metabolism
    SCA_1964 (fbp)
Enzymes [BR:sca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SCA_1964 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos_2
Motif
Other DBs
NCBI-ProteinID: CAL28870
UniProt: B9DL31
Position
1976756..1978708
Genome map
AA seq 650 aa AA seqDB search
MKTTDRELKHKYFDLLAEKFNHEEQLATEIISLESILELPKGTEHFVSDLHGEYDSFQHV
LRNGSGNVRTKVNDIFQNTMSNQEISDFTALIYYPEDKLKLVKSSFDAKQPLNRWYEETI
EQMIQMILYSASKYTRSKLRKALPKQFVFIIEELLYKNNGLDNKTPYYNTLMNQIIETQQ
ADDLIIGMSYTIQRLVVDHLHVVGDIYDRGPEPEKIVETLIDYHSVDIQWGNHDAIWIGA
YAGSKVCLANILRICARYDNLNIVEDAYGINIRPLLNLAEKFYGDNPAFRPKLRSDSNLS
EQEQLQITKIHQAIAMIQFKLEIPIIKRRPSFEMEDRLVLEHVDYDNLTYTLHGKTHDLT
DTCFVTVDPEDPAKLLPEEQEVIDKLLISVQESEKLKRHMTFLMDKGCLYLPYNGNLLIH
GCIPIDENGKMEGMEIDGEFYSGRQLLDQFEKYMRKAFRHKDVTDDLATDLVWYLWTGKY
SSLFGKRAMTTFERYFIKDKATHKEEKNPYYSLRENPEIVGHLLEEFGLDPDQGHIINGH
TPVKEIDGEDPIKADGKMIVIDGGFSKVYQSTTGIAGYTLLYNSYGMQLVAHQHFNTKEN
VLRYGADELSTKRVVDEELTRKRIRDTNKGQLIQEEIDNLKDLMAHRYFE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccacagatcgtgaacttaaacataaatactttgacttacttgcagaaaaattt
aatcacgaagaacaactcgctacagaaatcatcagtctagaatctatcttagagttgcca
aaaggcactgaacactttgtcagtgatttacatggagaatatgattctttccaacatgta
ttaagaaatggttcaggcaatgtacgtactaaagttaatgacattttccaaaatacaatg
tccaatcaagaaatcagtgatttcactgctttaatctattatccagaagataagttgaaa
ttagttaaatctagttttgatgctaaacagcctttaaatagatggtatgaagaaactatc
gaacaaatgattcaaatgattttatattcagcttcaaaatacacgcgttctaaattacgt
aaagcattgccgaaacaattcgttttcattattgaagaactgctttataaaaataacggt
ttagacaataaaacaccttattacaatacattgatgaatcaaattatcgagacacaacaa
gcagatgatttaatcatcggcatgtcttatactattcaacgtttagtcgtcgaccacctt
catgtagtcggtgatatttatgaccgtggtccagagcctgaaaaaatcgttgaaacttta
attgattaccattctgtagacatccaatggggcaaccacgatgcaatttggatcggtgct
tatgcaggttctaaagtttgtttagccaatatcttaagaatttgtgcacgttacgataac
ttaaacattgtcgaagatgcttatggtatcaatatacgtccgctgttaaaccttgcagaa
aaattttacggagacaatccggcatttcgtcctaaattacgttctgattcaaatttatca
gaacaagaacaactgcaaatcaccaaaattcaccaagccatcgccatgatacagttcaaa
ttggagattccaatcattaaacgccgtccttcattcgaaatggaagatcgattagtatta
gaacatgttgattatgacaatttgacttatacattgcacggtaaaacacatgatttaaca
gatacatgttttgtgacagtagaccctgaagatcctgcaaaattattgccagaagaacaa
gaagtaatagataaattattaatttctgttcaagaatctgagaaattaaaacgacatatg
acattcttaatggataaaggttgtctttacttaccttataacggcaatctccttatacat
ggctgtattccaattgatgaaaacggcaaaatggaaggcatggaaattgatggagaattt
tattctggccgtcaattgcttgatcaattcgaaaaatatatgcgtaaagcattccgccat
aaagatgttacagatgatttagcaactgatttagtatggtatttatggacaggcaaatat
tcttcactattcggcaagagagcgatgacgacttttgaacgttatttcataaaagataaa
gcaacacacaaagaagaaaaaaatccttattattctttacgtgaaaacccagaaatcgtc
ggtcatttattagaagaattcggattagatccagatcaaggccatattattaacggtcat
acaccagtcaaagaaattgatggtgaagatcctatcaaagcagacggtaaaatgattgtc
attgatggcggtttttcaaaagtgtatcaatccacaacaggtattgccggctatacttta
ctttataattcatatggtatgcagctggtagcacatcaacacttcaatactaaagaaaat
gtattgcgttatggtgcagatgaattatcaacgaaacgtgtcgtagatgaagaattaaca
cgtaaacgcatccgtgatacaaataaaggacaattaatccaagaagaaattgataactta
aaagatttaatggcacatcgctattttgaataa

DBGET integrated database retrieval system