KEGG   Staphylococcus carnosus: SCA_2179Help
Entry
SCA_2179          CDS       T00863                                 

Definition
(GenBank) truncated UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sca  Staphylococcus carnosus
Pathway
sca00040  Pentose and glucuronate interconversions
sca00052  Galactose metabolism
sca00500  Starch and sucrose metabolism
sca00520  Amino sugar and nucleotide sugar metabolism
sca01100  Metabolic pathways
sca01130  Biosynthesis of antibiotics
Module
sca_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCA_2179
   00052 Galactose metabolism
    SCA_2179
   00500 Starch and sucrose metabolism
    SCA_2179
   00520 Amino sugar and nucleotide sugar metabolism
    SCA_2179
Enzymes [BR:sca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCA_2179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: CAL29084
UniProt: B9DJT3
Position
complement(2207638..2208273)
Genome map
AA seq 211 aa AA seqDB search
MNLESNGKFKELEKTKEPTNLVNLFYVRQKEQKGLGDAVLCAKQFIGNEPFAILLGDDIV
KGETPAIKQLMQKYEETGKSVIGVQEVQPSETHRYGIINPISSNGRLYQVNNFVEKPKEG
TAPSNLAIMGRYVLSPQIFNYLENQGIGAGGEVQLTDAIERLNQDDNVFAYDFEGKRYDV
GEKIGFVKTTIDFALNNDDMKDEITKFLKNL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagaatctaacgggaagtttaaagaattagaaaaaacaaaagagcctaccaat
ttagtgaatcttttttatgtacgtcaaaaagagcaaaaaggtttgggagatgcagtatta
tgcgcaaagcaatttattggaaatgaaccttttgccattttattaggagacgatattgtt
aaaggtgaaactccagcaatcaaacagttaatgcaaaaatatgaagaaactggcaaatca
gtgattggagtacaagaagttcaaccttcggaaacacatagatatggaattataaatcca
atttcttcaaatggacgattatatcaagtaaacaattttgtagaaaagccaaaagaagga
actgcaccatcaaatttggcaattatgggaagatatgttctttcaccacaaatcttcaac
tatcttgaaaatcaaggaattggcgcaggtggagaggtacagctcacggatgctatagaa
agattaaaccaagatgataacgtattcgcatatgactttgaaggtaagcgttatgatgta
ggagaaaaaattggatttgtaaaaacaacaattgattttgctttgaataacgatgatatg
aaagacgaaataacaaaatttttaaaaaatctgtaa

DBGET integrated database retrieval system