KEGG   Serinus canaria (common canary): 103813612Help
Entry
103813612         CDS       T05755                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
scan  Serinus canaria (common canary)
Pathway
scan04010  MAPK signaling pathway
scan04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103813612 (CACNA1I)
   04020 Calcium signaling pathway
    103813612 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:scan04040]
    103813612 (CACNA1I)
Ion channels [BR:scan04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103813612 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 103813612
NCBI-ProteinID: XP_030093796
Position
Unknown
AA seq 1848 aa AA seqDB search
MMVILLNCVTLGMYQPCEDMDCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCY
LGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDT
LPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFMEENFTVQGDIVLPPYYQPEEDDEM
PFICSLSGDNGIMGCHEIPPLKERGHECCLDKDDYYYYNSVRQEFNVSGMCVNWNQYYNV
CRTGNANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVG
SFFMINLCLVVIATQFSETKQREHQLMQEQRARYLSSSTVASYMEPGDCYEEIFQYVCHI
LRKAKRRTLGLYNSVQSWRHGQEPGPAKPSGSRKSQRHHRLCQQHNSLGCPPQGLVQPIA
VTATSDPTNCPRCHRAEHEASRSLSVLDSAGSDQEDGGASEGEGEGSQEDQGASALEKEE
ELEEGGRLKLCSDMWREVRVKLRVIVDSKYFNRGIMIAILVNTISMGIEHHEQPEELTNI
LEISNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIIGQADGGLSVLR
TFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLR
TDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNY
VLFNLLVAILVEGFQAEGDANRSYSDEDQSSSNMEEFDQFQEVQEGSDPKLCAIPVTPNG
HLDPSLPSSNPPVASGGVTNSSRNSLQLDQIRVAVGSRKSSVMSLGRMTYDQRSLSSSRS
SHYGAWSRSGAWGSRRSSWNSLARGHSLKHKPPSAEHESLLSGEAHKAADGEPDGTGRVL
HHRRTLSLDNKGSCDLLELASVPSGHRVTHRLGAPPGASEHQDCNGKMPSIVKEIFPKMN
NHKERGEDDEEIDYSLCFRIRKMMEVYKPDWCELREDWSIYLFSPQNRFRLLCQTIIAHK
LFDHVVLAFIFLNCITIALERPQIEHRSTERIFLTVSNYIFTAIFVAEMTLKVVSLGLYF
GDQAYLRSSWNILDGFLVFVSLIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAP
GLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDIRNITNRSDCM
AANYKWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVINNNPWMLLY
FISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYY
ATYCHIRLLIHSVCTSHYLDIFITFIICLNVVTMSLEHYNQPVSLETALKYCNYLFTTVF
VFEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVL
RIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDEN
PCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCSHDDRSCLSNLQFISPLYF
VSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELEMEISHGLSSHKSGSPNSGQ
GKGAGTGGGGGRTEPEGHLCMRCYSPAQENLWLDSVSLIIKDSFDGELMIIDNLSGSVFH
HYSSPAMCEKCNHDKQEVQLAEMEALSLNSDKSSSILLGDESDNRNAAQLNPKEIKQDGQ
DNPDSTGADNLGECLLPASSEDGSTNPDSYLCEMENTPFDSVQSWLKHESNKGPEEVSCP
HNLPKISLQGSWASLRSPGVNCSLLHQSPESDTSLDSRSSSSAGSLHT
NT seq 5544 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgattttgctaaactgtgttaccctgggaatgtaccagccatgtgaggatatg
gactgcctttctgacaggtgtaaaatcttgcaggtgtttgatgatttcatcttcatcttc
tttgccatggaaatggtcttgaagatggtggccctggggatctttggcaagaagtgttac
cttggagacacctggaaccgcctggatttcttcattgtcatggctgggatggtggagtac
tccctggatctccagaacataaacctgtctgcaatccgtactgtccgtgtgctgagaccc
ctgaaggcgatcaaccgcgtgcccagcatgcgcatccttgtgaacctgctgctggacacc
ttgcccatgctggggaacgtccttcttctctgcttctttgtcttcttcatctttggcatc
atcggtgtgcagctgtgggctgggctgctccgcaaccgctgcttcatggaggagaacttc
acagtacaaggtgacattgtcctgcccccttattaccaaccagaggaagatgatgagatg
ccctttatctgctcgctgtcaggagataatggaattatgggctgtcacgaaatacccccg
ctgaaggagcgaggccatgagtgttgtttggacaaggatgattattattattacaattca
gtccggcaagagtttaatgtcagtggcatgtgtgtgaactggaaccagtactacaacgtg
tgccgcacaggcaacgccaacccgcacaagggtgccatcaacttcgacaacatcggctac
gcctggattgtcatatttcaggtgatcacacttgaagggtgggtggagatcatgtactat
gtgatggatgcccattccttctacaattttatctactttatcttgttgataatcgtgggc
tccttcttcatgatcaacctgtgcctggtggtcatcgccacgcagttctcggagaccaag
cagcgggagcaccagctgatgcaggagcagagggcccggtacctgtcctccagcacggtt
gccagctacatggagccgggcgactgctacgaggagatcttccagtacgtctgccacatc
ctgcgcaaggccaagcgccgcaccctggggctctacaacagcgtgcagagctggcgccac
gggcaggagcccggccctgccaaacccagcggcagcaggaaaagccagaggcaccacagg
ctttgccagcagcacaactctcttggctgccctcctcagggcttagtccagcccatcgcc
gtgacagcaacctctgatcccaccaactgcccccgatgccaccgggcagagcacgaggca
tccagaagtctctcagtgctggatagcgctggctcagaccaggaggatggaggagccagc
gagggggagggggagggcagccaagaggaccagggagcctcggcgctggagaaggaggag
gaactggaagaaggaggacggctgaagctctgcagtgacatgtggcgagaagtgagggtc
aagcttcgagtgattgtggacagcaagtatttcaaccgtgggatcatgattgcaatccta
gtgaacaccatcagcatgggcattgagcaccacgaacagccagaggaattgaccaacatc
ttggagatcagcaatgttgtcttcacaagcatgtttgccctggagatgatcctgaaactt
gctgcttttggtctctttgattaccttcgcaacccctacaacatctttgacagtatcatc
gtcatcatcagcatctgggagatcattggccaggcagacgggggcctgtccgtgctgagg
acgttccggctgctccgcgtgctgaagctggtgcggttcatgccggcgctgcgccgacag
ctggtggtgctgatgaagactatggacaacgtagccaccttctgcatgctcctcatgctc
ttcatcttcatattcagcatcttgggtatgcatatctttggttgcaagttcagcctcagg
acagacacaggagatacagttcctgaccggaagaatttcgactccctgctctgggccatc
gtcaccgtcttccagatcctaacccaggaggactggaatgttgtactctataatggcatg
gcctccacctcgccatgggcttctctctactttgtggctctcatgacatttgggaattat
gtactcttcaatcttctggtggccattcttgtggagggattccaggctgagggtgatgcc
aaccggtcatactcagatgaagatcagagttcttcaaacatggaggagtttgatcaattc
caagaggtccaggaaggctcagatcccaagctctgtgcaattcctgtgacacctaatggg
cacctggatccatccttgccctcttccaacccaccagtggcttctgggggggtcaccaac
tcttcacgcaactcactgcaacttgaccagatccgagttgctgttggctcccggaagagc
agtgtgatgtccctggggagaatgacttatgaccagcggtccttgtccagctcccgcagt
tcccactacggtgcctggagccgcagcggagcctggggaagccgtcgctccagctggaac
agcctggcccggggacacagcctgaaacacaaacctccctcagctgagcacgagtccctc
ctgtctggggaagcacacaaggcggcagatggggagccggatgggacaggaagggtgctt
catcaccgccggacactctctctggataacaaagggtcctgtgacctgctggagctggcc
tcggtcccttctggccacagagtgacccacaggctgggagcaccacctggggccagtgag
catcaggactgcaatggcaaaatgcccagtattgtcaaggagatcttcccaaagatgaac
aaccacaaagaacggggagaggatgatgaagaaatagattatagcctgtgctttcgcatc
cggaagatgatggaagtctataagccagactggtgtgagttacgggaagactggtccata
tatctcttctctccacagaacaggtttcgcctcctctgccagaccatcattgctcacaag
ctatttgaccatgtagtgctggccttcatcttcctgaactgcatcaccattgccctggaa
agaccccagattgaacacagaagcacggaaagaatctttctcactgtgtccaactacatt
ttcacagcaatatttgtagctgagatgacactgaaggtggtctctctaggcctgtatttt
ggggaccaggcttatctccgcagcagctggaacatcttggatggcttcttggtcttcgtg
tctctcattgacattgtggtctcagtggcctctgctggtggtgccaaaatcctgggggtg
ctgcgagtgctccggttgctgcgcaccctacgtcccctccgagtcatcagtcgagccccg
ggtctgaagctggtggtggagaccctcatttcttctctcaagcccataggaaacattgtc
ctcatctgctgtgctttcttcatcatctttggcatcctgggtgtgcagcttttcaagggc
aaattctaccactgcctgggggtcgacatcaggaacatcaccaaccggtctgactgcatg
gcagccaactacaagtgggtgcaccacaagtataacttcgacaacctgggacaggctctg
atgtccctctttgttctggcttccaaggatggctgggtcaatattatgtataatggactc
gatgctgtggctgttgaccagcagccagtgatcaacaacaacccctggatgctactctac
ttcatctcctttctcctcatcgtcagcttctttgtgctcaacatgttcgtgggggtggtg
gtggagaatttccacaagtgccggcagcaccaggaggctgaggaggcgcgccggcgggag
gagaagcgcctgcgacgcttggagaagaagcgaaggaaggcgcagcgtttgccgtactat
gctacctactgccacatacgcctccttatccattcggtctgcaccagccactatctggac
atcttcatcactttcatcatctgcctcaacgtggtcactatgtccttggagcactacaac
caacctgtgtccctggagaccgccctcaaatactgcaactacctgttcaccactgtcttc
gtgtttgaggcagtcctcaagctggtggcatttggtctgcggcgattcttcaaagacagg
tggaaccagctagatctggccattgtgctgctgtctgtcatgggcatcacattggaagag
attgaaatcaacgcagctctcccaattaaccccactatcatccggatcatgagggtgctg
cgaatcgcccgggtcctgaagctactgaagatggccacaggaatgcgagccctgctggat
acagttgttcaagccctgccacaggtggggaaccttggactccttttcatgctcctcttt
ttcatctacgctgctctaggagtggagctctttggaaaattggtgtgcaatgatgagaac
ccctgtgagggcatgagccgccacgccaccttcgagaactttgggatggccttcctcaca
cttttccaggtgtccacaggtgacaactggaatgggatcatgaaggataccttgcgtgac
tgcagccacgatgaccggagctgtctcagcaacctgcagttcatctccccactgtacttt
gtcagctttgtgctcacagcccagtttgtcctcatcaacgtggtggtagctgtgctcatg
aaacatctcgacgacagcaacaaggaggcccaggaggatgcagagatggatgctgagctt
gagatggaaatttctcacgggctgagctcccacaagtcaggctctccaaattcaggacag
ggaaaaggagcaggaacaggaggaggtggtggtagaacagaacccgaaggacatctgtgc
atgagatgttactctccagcccaggagaacttatggctggacagtgtctctttaattatt
aaggactccttcgacggggagttaatgatcatcgataacctatcgggctccgtcttccat
cattactcctcgccggccatgtgcgagaagtgtaaccatgacaagcaagaggtccagctg
gctgaaatggaagcattatccctcaactcagacaagtcctcttccatccttctaggagat
gagtcagacaatcgaaacgctgctcagctgaatcctaaggagatcaagcaggatggccag
gacaaccctgactccactggggcagacaatctgggggaatgcctgcttccagcatccagt
gaggatggctctacaaacccagacagttacctgtgtgaaatggagaatacaccttttgac
tcagttcagtcttggctaaagcacgaaagtaacaaagggcctgaggaagtctcatgtcca
cacaaccttcctaagatctctctgcaaggctcgtgggcatcactgagatctccaggtgtg
aactgctcacttctccatcagtcccccgagagcgacacgtcgctggacagccggagcagc
agctcggccggcagcctgcacacc

DBGET integrated database retrieval system