KEGG   Serinus canaria (common canary): 103814498Help
Entry
103814498         CDS       T05755                                 

Gene name
NOP58
Definition
(RefSeq) nucleolar protein 58 isoform X1
  KO
K14565  nucleolar protein 58
Organism
scan  Serinus canaria (common canary)
Pathway
scan03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:scan00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    103814498 (NOP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:scan03009]
    103814498 (NOP58)
Ribosome biogenesis [BR:scan03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    103814498 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT RNA_polI_A34 tRNA-synt_His DUF2247
Motif
Other DBs
NCBI-GeneID: 103814498
NCBI-ProteinID: XP_009086324
Position
Unknown
AA seq 527 aa AA seqDB search
MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS
TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI
RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY
IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRSNFASTDVSDILPEEIEEDVKAAAE
ISMGTEVSEEDINNIIHLCDQVIEISEYRTQLYDYLKNRMMAIAPNLTVMVGELVGARLI
AHAGSLLNLAKHPASTVQLLGAEKALFRALKTKRDTPKFGLIYHASLVGQSNTKNKGKIS
RMLAAKTALTIRYDALGENTSAEMGAENRLKVETRLRLLEERGIRRISGTGKALAKTDKY
QNKSEVKVFDPSGDSTLPVVSKKRKIQEVDEQDTEVAVKAKKFKAEMKEGAAVEDGEPVK
KKKKKKDKEKQAEEEMVLSEELPTSPITENTEKKKKKKKKMKDEAED
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgctgttcgagaccgccgccggctacgccatcttcaaggttctgaatgagaaa
aagcttcaagaagttgacagtctgtggaaagaatttgaaactcctgaaaaagcaaacaaa
atagtaaagctgaaacactttgaaaaatttcaggacacaacagaagcacttgctgcatcc
acagctcttgtagaaggcaagctcagcaagaatttgaagaagattctcaagaagatagtg
gcaaaagatgcccatgagcagttggctgtggcagatgccaaactcggaggtgtcataaag
gagaagctgaatttgagttgtatacacagcccaatggttacagagctgatgagaggaatt
cgctcacagattgaagggctcataacaggcctcccttctcgagagatggcagctatgtgc
ctgggtctggcacacagcctttcccgctacaagctgaaattcagcccagacaaagtagat
accatgattatccaggcaatttcccttcttgatgacttggacaaagagctgaacaactac
atcatgcgctgccgggaatggtacggctggcacttccctgagctgggcaaaatcatcaca
gacaacctgacctactgcaaatgtgtgcgcaaagtgggagacagaagcaattttgcttcc
actgatgtttctgacatcctaccagaggagattgaggaggatgtgaaggctgccgctgag
atttccatggggacagaagtatcagaagaagacataaacaacataatccatctctgtgat
caggtgattgaaatctcagagtatcggacacagctctatgactacctgaagaacagaatg
atggccattgctcccaacctcactgtcatggtgggagaactagtgggagcaaggctcatt
gctcatgcaggttccctcctgaatctggcaaagcacccagcttctacagttcagttactg
ggtgctgagaaggcactcttcagagcactgaagactaaaagggacacacctaagtttggc
cttatctatcatgcctctctggtgggacaaagcaataccaaaaataaaggaaagatttct
cgaatgctggcagcaaagactgccttgactattcgttacgatgcccttggagagaacacc
agtgctgaaatgggagctgagaacagactaaaagtagagacaagactaaggcttttggaa
gagagagggataagaagaataagtggcactggaaaagccttggccaagacagacaagtat
caaaacaagagtgaagtaaaagtgttcgacccctctggtgactcaacacttcctgttgtt
tccaagaagcgcaaaattcaggaggtggatgaacaggacacagaggttgcagtgaaagca
aagaagttcaaagcagagatgaaagaaggggcagctgtagaagatggtgaacctgtcaaa
aagaagaaaaagaaaaaggataaggaaaagcaagctgaagaagagatggtactgagtgag
gagctccctaccagccccataactgagaatacagagaaaaagaagaagaagaaaaagaaa
atgaaagacgaggctgaagactga

DBGET integrated database retrieval system