KEGG   Serinus canaria (common canary): 103814801Help
Entry
103814801         CDS       T05755                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2 isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00564  Glycerophospholipid metabolism
scan00565  Ether lipid metabolism
scan00590  Arachidonic acid metabolism
scan00591  Linoleic acid metabolism
scan00592  alpha-Linolenic acid metabolism
scan01100  Metabolic pathways
scan04010  MAPK signaling pathway
scan04217  Necroptosis
scan04270  Vascular smooth muscle contraction
scan04370  VEGF signaling pathway
scan04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103814801 (PLA2G4A)
   00565 Ether lipid metabolism
    103814801 (PLA2G4A)
   00590 Arachidonic acid metabolism
    103814801 (PLA2G4A)
   00591 Linoleic acid metabolism
    103814801 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    103814801 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103814801 (PLA2G4A)
   04370 VEGF signaling pathway
    103814801 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103814801 (PLA2G4A)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103814801 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103814801 (PLA2G4A)
Enzymes [BR:scan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103814801 (PLA2G4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 DUF2281
Motif
Other DBs
NCBI-GeneID: 103814801
NCBI-ProteinID: XP_009086667
Position
Unknown
AA seq 752 aa AA seqDB search
MSVIDPYQHIVVEHQYSHIFTVTVRKATNVTKGAIGDMLDTPDPYVELFIPTAPDCRKRT
KHFNNDINPVWDETFEFILDPNLENVLEVTLMDANYVMDETLGTSTFAISSLKLGEKKEV
QLTFNDVTEMTLELSLEVCSSTDLRFSMALCDEEKRFRQQRRDNIVHSIKSFLGENSHSL
SSSRDVPVIAVLGSGGGFRAMVGFAGVMKALYESGVLDCATYIAGLSGSTWYMSTLYSHP
DFPAKGPKEINEELMNSVSHNPLLLLTPQKVKRYIEALWNKKSSGQPVTFTDIFGMLIGE
TLIHDRMDTTLSNMKEKVNNAQCALPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGT
FMSPDLFGSKFFMGTVVKKYAENPLHFLMGVWGSAFSILFNRVLGVSNSQNKGPTMEEEL
ENIRLKHLVSNDSSDSEDESQHPKGTEGAEAKRECQGRLQESSQESWVQRMLMALVGDSA
LFNTREGRAGKVHNFMLGLNLNSCYPLSPLAELLTQESLEEEEPAAVADPDEFERIYEPL
DVKSKKIHIVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKEILLAEKWAK
MNKLPFPKIDPNVFDREGMKECYVFKPKDTSSEKDCPTIIHFVLANIDFRKYKAPGVPRE
TQEEKDFADFDIFDDPDTPFSTFNFQYPNEAFKRLHDLMEFNTLNNMDVIKEAMVESIEY
RKQNPSRCSVSLSSVEARRFFNKSNLNNNNHT
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcatagatccttatcaacacattgtggtggagcaccagtactcacacatattc
actgtgacagtaaggaaagccacaaatgtcaccaaaggagccattggtgacatgcttgac
actccagatccctacgtggagctgttcatccccactgcccctgactgcaggaagagaacc
aagcacttcaacaacgacatcaaccccgtgtgggacgagaccttcgagttcattctggac
cccaatctggagaatgtcctggaggttactctcatggatgccaactatgttatggatgag
actcttggcacatccacgtttgccatctcttctctgaaactgggagagaagaaggaggtc
cagctaactttcaatgatgtcacagaaatgactttggaattgtctctggaagtatgctcc
tccacagacctgcggttcagcatggccctgtgcgatgaggagaagaggttccggcagcag
cgcagagacaacatcgtgcacagcatcaaatcattcctgggggagaacagccacagcctg
agctcctcccgtgatgtgccggtgatcgccgtgctgggctcgggaggggggttccgggcc
atggtgggctttgctggagtcatgaaagcactttatgagtcaggagtcctggactgtgcc
acctacattgctgggctctctggatccacctggtatatgtcaactctgtattcccaccct
gacttcccagccaagggcccaaaggagatcaatgaggagctgatgaactctgtgagccac
aaccccctgctgctgctcacccctcagaaggtcaagcgctacatcgaggctctgtggaac
aagaagagctcagggcagcctgtcaccttcacagacatctttggcatgctcataggggaa
acactgatccatgataggatggacaccactctgagcaacatgaaagagaaggtcaacaat
gcccagtgtgctctgccactcttcacctgtctgcacgtcaaaccagatgtgtcagagctg
atgtttgcagactgggtggaattcagtccatatgaaattggaatggccaagtatggcact
ttcatgtctcctgatctgtttggaagcaagttttttatggggacagtggtgaagaaatat
gctgaaaatcccttgcatttcctgatgggtgtctggggcagtgcattttcaatattgttt
aacagagtccttggtgtctccaattctcagaataaagggcccaccatggaagaagaatta
gaaaatattaggctaaagcaccttgtgagcaatgacagctcagacagtgaagatgagtca
cagcatccaaaaggcacggagggcgccgaggccaagcgggagtgccaggggaggctgcag
gagagcagccaggagagctgggtgcagcgcatgctgatggcgctggtgggggacagcgcc
ctgttcaacacgcgcgagggccgcgccggcaaggtgcacaacttcatgttggggctgaac
ctcaacagctgctaccccctgtcccctctggcagagctgctcacccaggagtcgctggag
gaggaggagccggcagcagtggcagatcctgacgagtttgagaggatctatgagcccctg
gatgtgaagagcaagaagatccacatagtggacagtgggctgacctttaacctgccctac
ccgctcatcctgaggccccagagaggtgtggatctcatcatctcctttgatttctcagcc
aggccaagtgattccagccctcctttcaaagaaatcctgctggctgaaaaatgggccaaa
atgaacaagcttcctttccccaagatagaccccaacgtgtttgacagggagggcatgaag
gagtgctacgttttcaaacccaaggacacctcctcggagaaggactgtccaaccatcatc
cactttgtgctggccaacattgacttcaggaagtacaaagctccaggtgttcccagagaa
acacaagaagagaaggattttgcagacttcgatatttttgatgatccagacacgcctttc
tctaccttcaacttccaatatcccaacgaggctttcaagaggctccatgacctcatggag
ttcaacaccctgaataacatggatgtgatcaaggaggcgatggtggagagcatcgagtac
aggaagcagaacccctcgcgctgctccgtgtccctcagcagtgtggaggccaggaggttc
ttcaacaagagcaacctcaacaacaacaaccacacatag

DBGET integrated database retrieval system