KEGG   Serinus canaria (common canary): 103814959Help
Entry
103814959         CDS       T05755                                 

Gene name
ST3GAL3
Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X2
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00514  Other types of O-glycan biosynthesis
scan00515  Mannose type O-glycan biosynthesis
scan00533  Glycosaminoglycan biosynthesis - keratan sulfate
scan00601  Glycosphingolipid biosynthesis - lacto and neolacto series
scan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    103814959 (ST3GAL3)
   00514 Other types of O-glycan biosynthesis
    103814959 (ST3GAL3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    103814959 (ST3GAL3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103814959 (ST3GAL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:scan01003]
    103814959 (ST3GAL3)
Enzymes [BR:scan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     103814959 (ST3GAL3)
Glycosyltransferases [BR:scan01003]
 Terminal extension
  Sialyltransferase
   103814959 (ST3GAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 103814959
NCBI-ProteinID: XP_009086887
Position
Unknown
AA seq 374 aa AA seqDB search
MGLLVFMRNLLLALCLFLVLGFLYYSAWKLHLLRWEDSNSVVLSFDSVGHTIGSEYDKLG
FLLNLDSKLPPELASKYANFSEGMCKPGYASALMTVIFPKFSKPAPMFLDDSFRKWARIR
DFVPPFGIKGQDNLIKAILSATKDYRLTPALDSLSCRRCIIVGNGGVLANKSLGLKIDDY
DVVVRLNSAPVKGFEKDVGGKTTLRITYPEGAIQKMEQYEKDSLFVLAGFKWQDFKWLKY
IVYKEKVSASDGFWKSVATRVPREPHEIRILNPYFIQEAAFSFIGLPFNNGLMGRGNIPT
LGSVAITMALHNCDEVAVAGFGYDMSSPNAPLHYYENIKMSAIKESWTHNIQREKEFLRK
LVKARVITDLTSGI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggactcttggtgtttatgcgtaacctgctgctagccctctgcctctttctggtactg
ggatttctgtactattctgcttggaagttgcaccttctcagatgggaggattcaaattca
gtggttctttcctttgactccgttggacatacaataggctcagaatatgacaaactgggc
tttctcctgaacctggactcaaaattgcctccagaactggcatcaaagtatgccaatttc
tctgagggaatgtgcaagccaggctatgcatcagcgctcatgactgtcatcttcccaaag
ttctccaagccggcaccaatgttcttggacgattccttcaggaaatgggcacgtatcagg
gactttgtacccccctttggaattaaaggacaagataatctgatcaaagccatcctgtca
gcaaccaaagattatcgtctaactccagctcttgacagtctcagctgccggcgatgtatt
attgtgggaaatggtggagtacttgcaaataagtcattggggttaaaaattgatgactat
gatgttgttgtcaggctgaactcggctccagtgaagggctttgaaaaagacgtgggtggc
aagacaacgctccggatcacatatcctgaaggtgcaatccagaaaatggagcagtatgag
aaggattccctgtttgttctggcaggattcaaatggcaggatttcaagtggctgaaatac
attgtttacaaggagaaagtgagtgcctctgatggcttttggaagtcagtggcaacccgt
gtccccagggagcctcatgagatccgtatcctgaatccctacttcatccaggaggcagct
ttcagcttcattggactgcctttcaacaacggcctgatgggcagagggaacatccccacc
ctgggaagcgtagcaataaccatggcgctgcacaactgtgatgaggtggcggtagctggc
tttggctatgacatgagctcccccaatgcaccgctgcactactatgagaacatcaagatg
tctgccatcaaagagtcctggacgcacaacatccagcgggagaaggaatttctgagaaag
ctggtgaaagcccgagtcatcactgacctgaccagtgggatctga

DBGET integrated database retrieval system