KEGG   Serinus canaria (common canary): 103815279
Entry
103815279         CDS       T05755                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X4
  KO
K04462  ecotropic virus integration site 1 protein
Organism
scan  Serinus canaria (common canary)
Pathway
scan04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103815279 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:scan03000]
    103815279 (MECOM)
Transcription factors [BR:scan03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    103815279 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED zf-met Zn-ribbon_8 zf-C2H2_11 zinc_ribbon_15 PyrI_C
Other DBs
NCBI-GeneID: 103815279
NCBI-ProteinID: XP_018768288
Position
Unknown
AA seq 1045 aa
MKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELLDHQKFPCSTPHSAFSMVEEDFQK
KLENENDLQDVHEIQECKECDQVFPDLQSLEKHMLSHSEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLLPTSSPVKGLPSADQTNKSQSPLLTNPQILPATQDILKALNKQ
PSVGENKPVELQPEGSSEERPHEKLSDQSESSDLDLDDVSTPSGSDLETTSGSDLESDIE
SEKEKFKENGKMFKDKVSSLQSLASINNKKDHSNHSIFSPSLEEQTAVSGAVNDSIKAIA
SIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKVEPQS
PSEIKKIPKGSSESPFDLTIKRKEEKPLTPIPSKPAAPSASSQDQPLDLSMGSRSRASST
RQAEPRKNHVFGEKKGGDLEQRKASESSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEK
YLRPSPGFLFHPQVSAIENMAEKLESFSALKPEASELIQSVPSMFNFRAPPSALPETLLR
KGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKE
KPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDSYFTEI
RNFIGNSNHNNQSPRNSEERMNGSHFKDEKAMVASQNSDLLDDEEAEDEVMMDEEDEESE
MAGKAVKEPVTSDMHEGTPEEDYEETSTLDMNCKASPGRYKEEEYNKTGLSALDHIRHFT
DSLKMRKMEENQYSEAELAAFNASQLPEDLKQPLYRKSKSQAYAMMLSLSEKDSLHSASH
SSPNMWHSMARAAAESSAIQSISHV
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgaagagtgaagattattcacatgaaaccatggctccggacatccacgaggagcgccag
taccgctgcgaggactgtgaccagctctttgagtccaaggctgagctgctggaccaccag
aagttcccctgcagcacacctcactctgccttctccatggtggaggaggacttccaaaag
aagctcgagaacgagaatgaccttcaggacgtgcatgagatccaggagtgcaaagagtgt
gaccaagtcttcccagacttacagagcctggagaagcacatgctgtcacacagtgaggag
agggagtacaagtgtgaccagtgccccaaagctttcaactggaagtccaacttgatacgt
caccaaatgtcacacgacagtgggaagcactacgagtgtgagaactgtgccaaggttttc
acggaccccagcaaccttcagaggcacattcgttcccagcatgtgggggctcgtgctcac
gcttgtccagagtgtggcaaaacctttgccacttcttcaggcctcaaacagcataaacac
atccacagcagtgtcaaaccttttatatgtgaggtctgccataaatcctatactcagttt
tcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgcaaa
gactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagattttgtgag
ggcaagaaccattttgcagcaggaggattttttggccaaggcatttctcttcctggaacc
ccagctatggataaaacgtccatggttaatatgaatcatgcaaatccgggccttgctgac
tattttggagccaataggcatcctgctggtcttacctttccaacagctcctggattttct
tttagcttccccggtctgtttccttcaggcttgtaccacaggccacctttgctacctact
agttctcctgttaaaggacttccgagcgcagatcagacaaacaaaagccaaagtcccctc
ctgacaaatcctcagatactgccagccacccaggatattttgaaggcactaaataaacaa
ccatcagtaggggagaataagccagtggagcttcaaccagaagggtcctctgaagagagg
ccacatgagaaactcagtgaccagtcagagagtagtgaccttgaccttgacgatgtcagt
acccccagtggcagtgacctggaaaccacctcgggctctgatctggaaagtgacattgaa
agtgagaaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagctctctg
cagagcctggcgtcaataaataataagaaagaccacagcaatcattccattttctcacca
tccttagaggagcagactgcggtgtcaggagcggtgaatgattctataaaggctattgct
tctattgctgaaaagtactttggttcaacaggacttgtggggctgcaagacaaaaaagtc
ggagccttaccttacccttccatgtttcccctcccgttttttccagcattctctcaatca
atgtatccatttcctgatagagacttgagaccgttacccctgaaagtggagccccaatca
cccagtgaaattaagaagatcccaaagggaagctctgagtctccctttgacctcaccata
aaacgtaaggaggagaagccactcactcccatcccctcaaagccagcagccccctctgca
tccagccaggaccagcctctggatctcagcatgggcagccgaagccgagccagcagcaca
aggcaggctgagcctcggaaaaaccacgtctttggagagaagaaaggaggagacctcgag
cagaggaaagcttcagagtcctctttgcagcacgccaggcccaccccattctttatggat
cccatttacagagtagaaaaaagaaagctaactgacccactggaagctttaaaagagaag
tacttgagaccttccccgggattcttgtttcatccacaagtgtcagctatagaaaacatg
gccgagaagctggagagtttcagcgccctgaaacccgaggccagcgagctgatccagtcg
gtgccgtccatgttcaacttccgcgcgccgcccagcgcgctccccgagacgctgctgcgc
aagggcaaggagcgctacacctgcagatactgtggcaagattttcccgaggtctgcaaac
ctgacccgtcacctgaggacgcacactggagagcagccctatagatgcaaatactgtgac
agatccttcagcatatcctctaacctgcagagacatgtgcgtaacatccacaataaagag
aagccattcaagtgtcacttgtgtgacaggtgttttggtcaacaaaccaatcttgacaga
catctaaaaaagcacgagaatgggaacatgtctggtactgcaacatcttcacctcactca
gaactggaaagcacaggggcaatcctagatgacaaggaggactcttacttcacagaaatt
aggaattttattggaaacagcaaccacaacaatcaatccccccgaaactcagaggagaga
atgaatggcagccactttaaggatgaaaaagccatggtagccagccagaactcggatctg
ctggatgacgaggaggcagaagatgaagtaatgatggatgaagaggatgaagagagcgaa
atggcagggaaagcagtcaaagagcccgtgacgagtgacatgcatgagggcactcccgag
gaggattatgaggaaacgagtactttggacatgaactgcaaagcttcccctggcaggtat
aaagaagaggagtataataagactggactttcagctttggaccacataaggcacttcaca
gatagcctcaaaatgaggaaaatggaagaaaatcaatacagtgaagctgaattggcagct
ttcaatgcttcccagctgccagaggacctcaagcaaccgttgtacaggaaatccaaatcc
caggcctatgccatgatgctctctctctccgagaaggactcccttcattctgcatcccac
agttctcccaacatgtggcacagtatggcgagagccgcggcggaatccagcgccatccag
tccatcagccacgtatga

DBGET integrated database retrieval system