KEGG   Serinus canaria (common canary): 103815501Help
Entry
103815501         CDS       T05755                                 

Gene name
PPP1R7
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 7 isoform X2
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:scan01009]
    103815501 (PPP1R7)
Protein phosphatases and associated proteins [BR:scan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103815501 (PPP1R7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8
Motif
Other DBs
NCBI-GeneID: 103815501
NCBI-ProteinID: XP_009087552
Position
Unknown
AA seq 355 aa AA seqDB search
MAAESGAGPQEMMEVDKRIESEESGDEEGRKQAVRLVTELSQQSLRDEQNGENSAGEAET
PVDMETISLDPEAEDVDLNHFRIGKIEGFEVLKKVKTLCLRQNLIKHIENLEQLQTLREL
DLYDNQIRKIENLEALVDLEVLDISFNVLRHIEGLDRLTQLKKLFLVNNKISKIENLSSL
QTLQMLELGSNRIRVIENIDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKI
EGLQSLVNLRELYLSHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELQEFWMND
NLVESWSDLDELKGAKNLETVYLERNPLQKDPQYRRKIMLALPTVRQIDATFVRF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagagcggagcggggccgcaggagatgatggaggtggataagaggatcgag
tccgaggagtcgggggacgaggaggggaggaagcaggcggttcgcttggtgacagagctg
agccagcagagcctgcgggatgagcagaacggcgagaactccgcaggagaagcagagacc
ccagtggacatggagaccattagcctggaccccgaggctgaggatgttgacttgaatcat
ttccggattgggaagattgaaggatttgaggtgctcaagaaagtgaagactctgtgtctg
cgtcagaacttgattaagcacattgagaacctggagcagctgcagaccttgcgggagctg
gatctctatgacaatcagatccggaagattgagaacttggaggctctggtggaccttgag
gtactggacatctcctttaatgttctgaggcacattgaagggctggatcggctcacccag
cttaaaaagctcttccttgtcaacaacaaaatcagcaaaattgagaatttgagcagcctg
cagacgctgcagatgttggagttgggctccaatcgaattcgggtaattgaaaacattgac
accttgactaatcttgacagtctgttccttggaaagaataaaatcaccaagctccagaac
ctggatgccctgacaaacctgactgtgctcagtatacagaataaccgtctgaccaagatt
gaggggctgcagagcctggtgaacctgcgggagctgtacctgagccacaacggcatcgag
gtcatcgagggactggagaacaataacaaactcacaatgctggacattgcagccaacaga
attaagaagatcgagaacatcagtcacctaacagagctgcaggagttctggatgaatgac
aacctcgtggagagctggagcgacctggatgagctgaaaggagccaagaatttggagact
gtatacctggagagaaaccccctgcagaaagacccccagtaccggcgcaaaatcatgctg
gccctcccgactgtgcggcagatcgacgccaccttcgttcggttctga

DBGET integrated database retrieval system