KEGG   Serinus canaria (common canary): 103816476
Entry
103816476         CDS       T05755                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
scan  Serinus canaria (common canary)
Pathway
scan04080  Neuroactive ligand-receptor interaction
scan04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103816476 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103816476 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 103816476
NCBI-ProteinID: XP_009088718
Position
Unknown
AA seq 80 aa
MAAPRRLLAPLLLLLLLLGLVLAAPGPLGKAPDGKDAQDGLTRRLVRPRGARRGTSQRPG
GWRRYRRPRPRLSHKGPMPF
NT seq 243 nt   +upstreamnt  +downstreamnt
atggccgcgccgcgccggcttctggccccgctgctgctgctgctgctgctgctcgggctc
gtcctggccgcccccgggccgctggggaaggcgccggacgggaaggatgcccaggacggt
ctcacccggaggctggtgcggccgcggggtgcacggcgtgggaccagccagcgaccgggg
ggctggcggaggtaccggcggccccggccccggctctcccacaagggccccatgccattc
tga

DBGET integrated database retrieval system