KEGG   Serinus canaria (common canary): 103816736Help
Entry
103816736         CDS       T05755                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00232  Caffeine metabolism
scan00983  Drug metabolism - other enzymes
scan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    103816736
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103816736
Enzymes [BR:scan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     103816736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 103816736
NCBI-ProteinID: XP_009089000
Position
Unknown
AA seq 290 aa AA seqDB search
MNLEEYFARTGYKGSTEKQDLETLTDIFQHHIRAVPFENLSIHCGEKITLELEHVYNKIV
QRKRGGWCMENNQLLGWVLKGLGYDTSFLGAYVFNPQQNAYATRMTHLMVKVVINGKAYV
VDGGFGVSYQMWQPMELVSGKEQPQAPGVFRFTEKNGVWYLEKMRRKQYIPNQSFSNSDL
LEKKECRKVYMFSLEPRTVEDFRFQCTYLQTSPDSLFTRKSICTLQTTDGFRALIGWTLT
ETTYNYKENMDLVEFVTLEDEEVEKALKEKFNITLERKLVPINVKASYTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttgaagagtattttgcaagaactggctataaaggctccactgaaaaacaagat
ttggaaaccttaaccgatatattccagcatcacatccgcgctgttcccttcgaaaacctc
agcatccactgtggggagaaaattactttggagttggagcacgtttacaacaagattgtg
cagaggaagaggggtggctggtgcatggaaaacaaccagctgctgggctgggtgctgaag
ggcctgggctatgacaccagcttcctgggagcctacgtgttcaacccccagcagaacgcc
tacgccacgcgcatgacccacctcatggtaaaggtcgtcatcaatggcaaagcctacgtc
gttgatggaggctttggggtgtcctaccagatgtggcagcccatggagctcgtgtcaggg
aaagagcagccccaggctcccggcgtgttccgcttcacggagaaaaacggcgtctggtac
ctggagaaaatgagacggaaacaatacatccccaaccagagcttctccaactccgacctg
ctggagaaaaaggagtgtcgcaaggtttacatgttcagcctcgagccacggacagtggaa
gatttccgtttccagtgcacatacctccagacctctccagattccctcttcacaaggaag
tccatctgcaccctccagaccaccgatggattccgggcgctgattgggtggacactcact
gagaccacgtacaactacaaggaaaacatggatctggtggaatttgtaactcttgaagat
gaagaggtggaaaaagccctcaaagagaaatttaatatcaccctagagagaaaacttgtc
cccattaatgttaaagcatcttacacaatctag

DBGET integrated database retrieval system