KEGG   Serinus canaria (common canary): 103817288
Entry
103817288         CDS       T05755                                 

Definition
(RefSeq) deoxycytidine kinase-like isoform X2
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00230  Purine metabolism
scan00240  Pyrimidine metabolism
scan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103817288
   00240 Pyrimidine metabolism
    103817288
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103817288
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28
Other DBs
NCBI-GeneID: 103817288
NCBI-ProteinID: XP_009089671
Position
Unknown
AA seq 364 aa
MANLFTEMQIRSVKWNRATATSWTKLSSPFHLSNAHFVTPRRREPGRSGGGGGSASASSR
GGRAGSSHPAHPPGGTLKVRWSRREPLEFPLGTAMSTPAKRHCQSPAGSLESSFQKRLRK
ISIEGNIAAGKSTFVRLLEKHSDEWEIIPEPIAKWCNIQTAEDEYKELSTSQKSGGNLLQ
MLYDKPTRWAYTFQTYACLSRVKAQLKPLSAKLYEAEHPVQFFERSVYSDRYVFASNLFE
SGSINETEWSIYQDWHTWLLNQFQSDIELDGMIYLRTTPQKCMERLQLRGRKEEQGIELE
YLENLHYKHETWLHERTMRVDFENIKEIPILVLDVNEDFKNDKIKQEYLIDKVKSFLTSL
EDEN
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcgaacttgtttacagaaatgcaaattagatcagttaagtggaaccgtgctacagcc
acttcctggacaaagctctcttctccatttcacttgtcgaacgcccattttgtaacaccg
cggcggcgggagccgggcaggagcggcgggggagggggcagcgcctccgcctcttcccgg
ggaggacgggcgggaagcagccatcccgcccacccgcctggcgggacgcttaaagtgcgc
tggagcagacgggaaccccttgagttcccgctcggcaccgccatgtctacccccgccaag
cgacactgccagagccccgccggctccctcgaatccagcttccagaagcgcctcaggaag
atttccatcgaggggaacatcgctgcggggaagtcaacgtttgtcaggctgctggagaaa
cacagcgatgagtgggagatcatccccgagcccatcgctaagtggtgcaacatccagaca
gccgaggatgagtataaggaactttcaacatctcagaagagcggaggaaacttacttcaa
atgctgtatgacaaacccacaagatgggcttacacatttcagacttatgcctgcctaagc
cgagtaaaagcacaattaaaacctctctcagccaagctgtacgaagcagaacatccagtg
caattttttgaaagatctgtgtacagtgacagatacgtgtttgcttctaacctgtttgag
tctggaagtattaatgaaacagagtggtctatttatcaggactggcacacatggcttttg
aatcagtttcaatcagatatagaactggacggcatgatctatctcagaaccacacctcag
aaatgcatggaaaggctacagctgaggggaagaaaagaggagcaaggaattgagcttgag
tatttggaaaacctccactataaacatgaaacctggcttcatgaaaggactatgagagtt
gattttgagaacattaaggagattcctattctagttttggatgttaatgaagattttaag
aacgataaaattaaacaagagtacctgattgataaagtcaagtcattcctgacttcttta
gaagacgaaaattaa

DBGET integrated database retrieval system