KEGG   Serinus canaria (common canary): 103818409Help
Entry
103818409         CDS       T05755                                 

Gene name
TMPRSS15
Definition
(RefSeq) enteropeptidase
  KO
K01316  enterokinase [EC:3.4.21.9]
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:scan01002]
    103818409 (TMPRSS15)
Enzymes [BR:scan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.9  enteropeptidase
     103818409 (TMPRSS15)
Peptidases and inhibitors [BR:scan01002]
 Serine peptidases
  Family S1: chymotrypsin family
   103818409 (TMPRSS15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB MAM Ldl_recept_a SEA DUF1986 SRCR_2 SRCR CUB_2 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 103818409
NCBI-ProteinID: XP_030090621
Position
Unknown
AA seq 1055 aa AA seqDB search
MKLKKSSDEKYVSLSIYEIFFASLLAIFVCVCVGLLVLSWLSVQELERAEADVNTHRYMG
ILKIVSGTSFTSTLQNSSSADFKVLAFDVEKLIQNIFQEGDLKYKFERCEVSQFKKSEDD
HDRLTSETSVVVILTLYFTQMVTVEKIKHELVLGVIANNPNPTKALKIDVNSIQITVAAE
NPTTTTPLTSSDPTSLITSSLTPTSGSGLLTTSKPSTTVAECLPPAELCADGATCISEEF
FCDGVLNCPDGSDESEKRCAAVCDGKFMLTGSSGFFHSMNYPKPYNENIVCQWIIVVPQG
LSIKLNFTSFETQPYADELSIFEGLGQNKVLRASLSGTNLETIYIFSHEATAQFMSDYSE
NYNGFNATYTAFNASELNNYEKINCTFEDGFCFWIQDLDDDSDWERVQGPTFPFMSGPEF
DHTFGNFSGFYISTPIGLGFVEERVRILSLPLVPSDMYCLSFWYFMYGDNVYRLRVSISD
EHGQEKIVFEKEGNYGNDWNYGQVTLNETSDFKVIFDAFKRRGPSDIAVDDTGLTKGKCN
EDNYVEPTVRPTPATTPLIPTDCGGPVELWEPNSTFSSANFPNNYPNLASCVWYLNAENG
KNIQLHFQVFDLENIYDVVEIRDGRGPDSLLLAVYTEKGPLPDVFSTTNQMTVILRTDKS
ATRKGFLANFTSGYHLRPCTADKHQCGSGKCIPLHNLCDNIPQCEDGSDEAKCMRLLSGS
LSSEGLVQARVGRTWHLACADDWSGEIADSVCQLLGLGDANMSSAVLFTGNGPFVTITKG
GNHHLIFTKREHCWNNLVVHLQCNIQSCGKHLVTENNGTRIVGGNDARREAWPWIVSLHF
NFQPVCGASLVSDEWLVTAAHCVYGRQLKPSRWRAALGLYSQADLAQPPTVVQNIDRIII
NPHYMRETKDSDIALMHLQHKVQYTDYIQPICLPEKDQQFSPGINCSIAGWGSIRNEGPS
SDILQEAEVPLLSNEKCQQWMPKYNITENMLCAGYDMGRIDSCQGDSGGPLTFEDGDKWF
LVGVTSFGEKCALPQRPGVYARVTMFVDWIKTIIY
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaaaaatcatctgatgagaaatatgtttctcttagtatctatgagattttc
tttgcttctctgctggcaatttttgtgtgtgtttgtgttggacttcttgtactttcttgg
ttatcagtccaggagttggaacgagctgaagcagatgtgaatactcacaggtatatggga
atattaaaaatagtctctggtacatctttcacttcaaccttacaaaacagttcctcagct
gatttcaaagtccttgcctttgatgtcgaaaaattgatacaaaatatcttccaagaaggt
gatctgaaatacaagtttgaaagatgtgaagtctcccagttcaagaaatcagaagatgac
catgacagattgacatcagagaccagtgtggttgtgatcctcaccctttattttacccag
atggtaacagttgagaaaataaaacatgagctggttttgggtgtcattgcaaataaccct
aatcctaccaaggctttgaaaattgatgtgaacagcatacaaatcacagtagctgcagaa
aatcctactacaacaacgcctttaacctcatcagatcccacgagtttaattacaagttcc
ttgacaccaacttcaggttcaggactgctcactacaagcaagccctcaacaacagtggct
gagtgtttgccacctgctgaactctgtgctgatggtgcaacctgcatcagtgaagaattc
ttttgtgatggagtcttgaactgcccagatggttcagatgaatctgaaaagagatgtgct
gcagtttgtgatggaaaattcatgttgactggctcctctgggttttttcactctatgaat
tatccaaagccatataatgagaacattgtttgccaatggataatagtagtgcctcaaggg
ttgtccattaaactgaacttcacttcttttgaaacacaaccatatgcagatgagctgagt
atttttgaaggattaggacaaaacaaggttttaagagcttctctgtcagggaccaatctt
gaaacaatttacattttttctcatgaggctacagcacagtttatgtccgattattcagag
aattacaatggctttaatgcaacatacactgcatttaatgcgagtgaactaaacaattat
gagaaaatcaattgcacttttgaagacggcttttgtttctggatacaagatttagatgat
gattcagactgggaaagagttcagggtcctacctttcccttcatgagtggtcctgaattt
gatcatacatttggcaacttttcaggattttatatttcaacgcccattggacttggattc
gtagaagagcgagtccggattctgagtttgcctttggtcccttcagatatgtattgtcta
agcttctggtatttcatgtatggggataatgtttaccgtttaagagttagcatcagtgat
gagcatggtcaggaaaagatagtttttgagaaagaaggaaactatggaaacgactggaat
tatggacaagtaactttaaatgaaacatctgattttaaggttatttttgatgcctttaaa
aggcgtggtcccagtgacattgctgtggatgacactggcctgacgaagggaaagtgcaat
gaagacaattatgtagagccaactgtgaggccaactcctgccaccaccccattaattccc
actgactgtggagggccggttgaactctgggagccaaacagtacattcagctctgcaaac
tttccaaacaattaccctaatttagcttcttgtgtgtggtacttgaatgctgaaaatgga
aaaaacatccaacttcattttcaggtttttgatctggaaaatatttatgatgttgttgaa
atcagagatggcagaggaccagattccttacttttggctgtctacacagagaaaggccca
ctgccagatgtcttctctaccaccaaccagatgacagtgatcctccggacggacaagtct
gcaactaggaagggatttcttgcaaacttcacctctggctaccatctcaggccttgcaca
gctgataagcatcagtgtggtagtgggaagtgcatcccattgcacaacctgtgtgacaac
atacctcagtgtgaagatggctctgacgaagcaaaatgcatgagattactcagtggctct
ctgagctccgaagggctggtacaggccagggttgggaggacgtggcacctggcatgtgca
gatgattggagtggagagattgcagacagtgtttgccagctgctggggttgggggatgca
aatatgtcatcagctgtattattcactggaaatggcccatttgtcaccatcaccaaagga
ggtaaccaccacctaatttttacaaaaagagaacactgttggaacaacctggtggttcat
ctgcagtgtaacattcagtcttgtgggaaacacctggtaactgagaataatggaacaaga
attgtaggtggaaatgatgccagaagagaggcttggccctggatagtttcactccatttt
aatttccaacccgtttgtggagcttcccttgtcagtgacgagtggctggtgacagcagca
cattgtgtctatgggagacagctgaagccatcccgctggcgggcggctctcggcttgtac
agccaggcagacctggcacagcctccaacagtggtccaaaacatcgacaggataattata
aaccctcattacatgagggaaacaaaagacagtgatattgctctgatgcaccttcaacac
aaagtgcagtacacagattacatacaacctatctgcctaccagaaaaagatcaacagttt
tcaccaggaattaactgctccattgctggttggggtagtattaggaatgaaggtccctct
tcagatatattgcaagaagcagaggtccctctcctttccaatgaaaaatgccagcaatgg
atgccaaagtacaatattactgagaatatgctctgtgcaggctatgacatgggaagaata
gattcctgccagggggattcaggtggccctctgacatttgaagatggggacaagtggttt
ttggttggtgtgacatcatttggagaaaagtgtgcactgccccagcgaccaggagtgtat
gctcgagtcaccatgtttgtggactggatcaaaaccatcatctattag

DBGET integrated database retrieval system