KEGG   Serinus canaria (common canary): 103819131
Entry
103819131         CDS       T05755                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:scan01002]
    103819131 (ADAMTS13)
Enzymes [BR:scan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     103819131 (ADAMTS13)
Peptidases and inhibitors [BR:scan01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   103819131 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin ADAM_spacer1 Reprolysin_4 TSP1_spondin Reprolysin_3 Reprolysin_5 Reprolysin_2 TSP1_CCN Pep_M12B_propep Peptidase_M10 DUF3810
Other DBs
NCBI-GeneID: 103819131
NCBI-ProteinID: XP_030087001
Position
Unknown
AA seq 1398 aa
MTVSFALRALAVLPXGLCWLPEKFLGALDAGDVLSYFGTSSVADVPEFVVAEPACPCQEE
HFGLRLCRVQHCSIQAWGQLYAFEFLEDHALLSSSFVSSQVVNSSFILLKRFPGSCFAGG
KALQPPGARSRVTYCEGQLQGVVTVGEEKIHIRPVRSKDVALLKDLGFSSPHILFKSAAR
EAKPVRAGWAPPRLHKRAEAAVKHLELMVVAGPDVYLYHREDTERYILANLNIGAELLRD
ASLGAHFRVHLMQMLVLREPEAEVNITTNITSSLISVCEWSKKVNPQNDSDPQHADIVLY
ITRFDLELPDGNKELRGVTQLGGVCSSSWSCVITQDTGFDLGVTIAHEIGHSLGIAHDGE
GNLCSSSGYIMGSAGNHNSIDLTWSPCSREQFLALVSTGQTNCLNDLPDMDGSIPGWKPG
LYYGADEQCKIAFGSVATACTFADTNVDICKVLSCHVQPADKSSCTRLLVPLLDGTECGI
NKWCSKGQCSSLEELNPMAVVHGHWSAWSPLSPCSRSCGGGVVLRQRFCNNPRPAFGGQK
CHGASMQAEMCNTQACLITQQDFMAEQCAATNLKPLYLDVETPSFYTWTSAVGFAKGDLL
CKHMCRAVGKEFMVSRGDNFLDGTRCEQDDTEHHGDLHLCVMGRCRAFGCDGQMGSRKAM
DSCKVCGGDNSTCTKVSGSYTEGKAEEYVTLLSLPYNTTSVHVTNRKPLFTHLAVKVKGE
YVVAGKGKISLNVTYPSVLEDNQIKYQVFLTQDNLPSLEEIHVDGPTQEEIEIQVYRRYS
KKYGNATNPDITFSYFVPRESLTHVWIPQQGPCSVTCGEGVQPVAHVCFDQTKNEVTEDQ
KCLELPQPLPEHKPCVMEPCLYRWKMSQRDECSAVCGTGVAQQNLTCVQFHDGLETVVDD
SLCPAEEKPLSLVPCVVNVCPLGWDKEEDAHLLQPLEPLGHVQLENQTVYVWSPVAGECS
VSCGRGKTQLHYVCVAFDTKEETQEENCQPVPKPESRVEVCDLSPCPPRWKVSPAGPCSS
SCGLGLAVQLVTCVQTLHGQEVLQEEHLCPVAEKPLTTVPCVIRTCSYKWSFSEWSECST
SCGNGIQTRQDFCLSSLTHKPVNPLFCRHFPKAIVLRGCSAGPCPEQEGTQSPGAQLQPV
KPATHLPTSAAAPEHRHKDMGVPLSAGPREQTKPSGGVCGNLFLNATGIINMTGVESRDC
TVTIGRPLREEISVTILESSLNCTAGEVVLFSGRMMWRTGCRKLPLSLINSRTNTLIVKQ
RVVLPGNGVILQYNSRTATKKYYQDCDQQLFGPQGEIVNPGQFPAERQGVVCRTFITVAP
RQRISIRALSADLGPEGNQTHFNYILVRDVSTMRTVVFHGKKQFLWQSTGSQAEIEFHEN
VKDHRTHFWAEYHAIEPK
NT seq 4197 nt   +upstreamnt  +downstreamnt
atgaccgtcagttttgcgctgcgggcgctcgccgtgctcccgntggggctgtgctggctc
cctgagaaattcctgggcgctctggatgcgggagatgttctgtcttactttggaaccagc
tcagtggctgatgtacctgagtttgttgtggctgagccagcttgcccttgtcaagaagaa
cattttgggctgaggctctgtcgggtccagcactgctccatccaggcctgggggcagctc
tatgcctttgaattcctagaggaccatgccctcctttcctcctcctttgtgagcagccag
gtggtgaactcttcctttattttactgaagagattcccagggagctgctttgcaggtgga
aaagccctgcagcctcctggggccaggagcagagtcacttactgtgaagggcagctgcaa
ggagtggtcaccgtgggcgaggagaagattcacatcaggccagtcaggagcaaagatgtg
gctctgctgaaggacctcggcttctccagcccccacatcctcttcaaaagtgctgcaaga
gaggcaaagccagtcagagcagggtgggctcctcctcgcctgcacaagagggctgaggca
gctgtgaaacatctggagctgatggtggtggcagggccagatgtttacttgtaccacaga
gaggacacagaacgttacatcctggccaacctgaacattggagcagagctgctcagagat
gcctcactgggggctcatttcagagttcacctcatgcaaatgctggttttgagagagcca
gaggcagaggtgaacatcaccaccaacatcacctcctccctcatcagtgtctgtgagtgg
agcaagaaggtgaacccccagaacgactctgacccccagcacgctgacatcgtcctctac
atcaccaggtttgacctggagttgcctgatgggaacaaggagcttcgtggagtgactcag
ttagggggagtctgctcctcctcctggagctgtgtcattacccaggacactggctttgac
cttggagtcaccatagcccatgagattgggcacagccttggcattgcccatgatggagag
gggaatctgtgcagcagcagtggttacatcatgggctcagcaggaaaccacaacagcatc
gacctcacctggtctccctgcagccgggagcagttcctggcccttgtcagtacaggccaa
acaaactgcttgaatgacctgccggacatggacggcagcatcccggggtggaagcctggc
ttgtactacggagcagatgagcagtgtaaaattgcctttgggagtgtggccacagcttgc
acctttgctgacaccaatgttgacatctgtaaagttctctcatgccatgtacagccagca
gacaaatccagctgtactcggcttctggtgcccctcctggatggaactgagtgtgggatc
aacaagtggtgctccaaaggtcagtgcagctctctggaggaactgaaccccatggctgtg
gtccatgggcactggtctgcctggagccccctctccccctgctcccgcagctgcggcggg
ggggtggtgctgaggcagcgcttctgtaacaaccccaggcctgcttttggggggcagaag
tgccatggtgccagcatgcaagcagagatgtgcaatacccaggcctgtctgatcacccag
caggacttcatggctgaacaatgtgcagcaacaaatttaaagccactgtaccttgatgta
gaaacaccatccttttatacctggacctctgctgttggctttgccaaaggggacctgctc
tgcaagcacatgtgcagggctgtgggcaaggagttcatggtgagccgtggggacaatttc
ctggatggaaccaggtgtgagcaggatgacacagagcaccacggggatctccatctgtgt
gtcatggggagatgcagagcatttgggtgtgatggccagatgggctccaggaaggccatg
gattcctgcaaggtctgtgggggtgacaactccacctgcaccaaagtgagtggatcctac
acagaagggaaagctgaagagtatgtgacacttctgtccctgccctacaacactacctca
gtccatgtcaccaacaggaagcctctctttacacacctggctgtgaaggttaaaggagag
tacgtggtggctggaaaaggaaaaatctcactgaatgtcacctacccatcagttctggag
gacaaccagatcaaataccaagtgtttctcacccaggacaacctgccaagcctggaggaa
atccatgtggatgggccaacacaggaagaaattgaaatacaggtctacaggaggtactca
aaaaaatatggcaatgccaccaacccagacatcaccttcagctactttgtccccagggag
agcctgacccatgtgtggattcctcagcagggcccatgttcagtgacctgtggggaaggg
gtacagccagtggctcatgtgtgctttgatcagaccaagaatgaagtaacagaggatcag
aagtgtctggagctgccacagcccctcccagagcacaagccctgtgtcatggagccatgc
ctctacaggtggaagatgtctcagagagatgaatgctctgctgtctgtgggactggagtt
gcccagcagaacctgacctgtgtgcagttccatgatggcctggagactgtggtggatgac
agcctgtgcccagcagaagaaaagcccctctcccttgtgccatgtgtggtcaatgtctgc
cctttgggctgggacaaagaggaagatgcacacttacttcagcctctggagccacttggg
catgtccagctggaaaatcagactgtatatgtctggagccctgtagctggggagtgttct
gtctcctgtggtagaggtaagactcagctgcactatgtttgtgtggcttttgacaccaaa
gaagaaacccaggaggaaaactgtcagccagtgccaaagccagagagcagggtggaagtc
tgtgatctcagcccctgcccaccaaggtggaaggtaagcccagctgggccctgctcctcc
agctgtgggctgggcttggcagtgcagctggtcacctgtgtgcagaccctccatggccag
gaggtcttgcaggaggaacatttgtgccctgtggcagagaagcccctcaccactgtcccc
tgtgtcatccgcacgtgctcttacaagtggagcttcagcgagtggtcagagtgttcaaca
tcctgtgggaatggcattcagaccaggcaggatttctgtctcagctctctgacccacaag
cctgtgaacccccttttctgccggcacttccccaaggccatcgtgctgcgtggctgctct
gcagggccctgtcctgagcaggaggggacccagtcccctggggcacagctgcagccagtg
aaaccagccacacacctgccaacatctgcagctgccccagagcacagacacaaggacatg
ggtgtgcctctgtctgctgggccccgggagcagacaaagcccagtggaggtgtctgtgga
aacctatttctcaatgccactggcatcatcaacatgacaggcgtggagagcagggactgc
acggtgaccatcgggcgtcccctgagggaggagatctcggtgaccatcctggagagctcc
ctcaactgcactgcaggtgaggttgtgctgttttctgggcgaatgatgtggcggacaggc
tgcaggaagctccctctgtccctgataaattccagaaccaacacactgattgtgaaacag
cgtgttgtgctgccaggaaacggggtcattctgcagtacaacagcagaactgcaaccaaa
aaatattaccaagactgtgaccagcagctgtttggcccccagggtgaaatagtgaatcct
gggcagtttcctgctgagaggcagggggtggtgtgccggactttcatcacggtggctccg
aggcagcgcatctccatccgtgccctcagtgctgacctgggccctgagggcaaccagact
cacttcaactacatcctggtccgagatgtcagcaccatgaggacagtggtgttccatgga
aagaagcagttcctgtggcagtcaacaggaagccaagctgaaattgaattccatgagaat
gttaaggatcacagaacccatttctgggctgaatatcatgctattgagcctaaataa

DBGET integrated database retrieval system