KEGG   Serinus canaria (common canary): 103819579Help
Entry
103819579         CDS       T05755                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like isoform X1
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00601  Glycosphingolipid biosynthesis - lacto and neolacto series
scan00603  Glycosphingolipid biosynthesis - globo and isoglobo series
scan01100  Metabolic pathways
Module
scan_M00068  Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103819579
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    103819579
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:scan01003]
    103819579
Enzymes [BR:scan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     103819579
Glycosyltransferases [BR:scan01003]
 Glycan extension
  P blood group
   103819579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug DUF1244 CotJA TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 103819579
NCBI-ProteinID: XP_018774134
Position
Unknown
AA seq 401 aa AA seqDB search
MRLERSSEITLKQPRINFCIWLQIMMAVSGEQALAGERMLRMPSCLLKLTRVVLSHKPCA
LFILIFVFVSFAYIKLYWGIEEDPKSHGPTYSLSAENGCAHYVPSPLDTAGGPSPSTGNV
FFVETSEQTSPSYLFSCSVESAARSHPTSRVVVLMKGLAKGNASLPKHWAFFLLSCFPNV
EIQPLDLTEFFSGTPLAQWFQQPQRQQEPYFLHVLSDACRIVLMWKFGGIYLDTDFIVLK
NLQNLTNALGIQDDNELNGAFLSFKAKHKFMELCMQDFVQNYNGWVWGHQGPGLLTRVFK
KWCSLETIKSMSCRGVSALAREVVYPIPWQNWKKLFEAVTALELQELLKSTYAVHIWNKL
SHETKLEIPSQALLAQLYSQFCPATYAKMKQDSEELSRRAV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagattggaaaggagttctgagatcaccttgaaacagcccagaattaatttctgcatc
tggctacagatcatgatggctgtctcaggagagcaggctctggctggagaaagaatgctc
aggatgcccagctgcctcctaaagctgaccagggtggtgctgagccacaagccctgtgcc
ctgtttatcctcatctttgtgttcgtatcctttgcctacatcaagttgtactggggcatt
gaggaggacccaaagagccacggccccacctacagcttgtctgctgagaatggctgcgct
cactatgtgccttctcccctcgacactgctggtgggccctctccttccacaggaaacgtg
ttttttgtggagacctcggagcaaacttccccaagttacctgttctcgtgctctgtggag
tctgcggccaggtcacaccccacgtcaagggtcgtggtgctcatgaaaggcttggccaaa
gggaacgcctccttgcccaaacactgggctttcttcttgctgagctgcttccccaacgtg
gaaatccagcccctggacttgacagagttcttttctggaacgcctcttgcacagtggttc
cagcagcctcagcggcaacaggagccttattttttacatgtcctctctgatgcctgcaga
attgtcctcatgtggaaatttggtggcatctacctggatacagacttcattgtgcttaag
aacttacagaacctcaccaatgcccttggcattcaggatgacaatgaactgaatggggcc
tttctgtcctttaaggccaagcacaagttcatggagctttgcatgcaggactttgtgcag
aattacaatggctgggtctgggggcaccagggcccagggctcctaactcgtgtcttcaag
aagtggtgctcccttgagactatcaagagcatgagctgcagaggtgtgagtgctcttgcc
cgagaagttgtttatcctattccctggcagaactggaagaagttgtttgaggcagtcact
gccttggagcttcaggaactccttaagagcacctatgcagtgcacatatggaacaaactg
agccacgagaccaagttagagatcccctcccaggctctgctggctcagctctattcccag
ttctgccctgccacctatgcaaagatgaaacaggactctgaagagttgtcaaggcgtgca
gtgtga

DBGET integrated database retrieval system