KEGG   Serinus canaria (common canary): 103819768Help
Entry
103819768         CDS       T05755                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
scan  Serinus canaria (common canary)
Pathway
scan04010  MAPK signaling pathway
scan04260  Cardiac muscle contraction
scan04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103819768 (CACNG5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103819768 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    103819768 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:scan04040]
    103819768 (CACNG5)
Ion channels [BR:scan04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103819768 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716
Motif
Other DBs
NCBI-GeneID: 103819768
NCBI-ProteinID: XP_009092569
Position
Unknown
AA seq 279 aa AA seqDB search
MLLAMSACSRKALTLLSSVFAVCGLGLLGISVSTDYWLYLEEGIVQPQNQTAEIKLSLHS
GLWRVCFLAGEERGRCFTIEYVMPMNIQLTSESTINVLKMIRSATPFPLVSLFFMFIGFI
LSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDSESFFNYKYG
WSFAFSAISFLLTESAGVMSVYLFMKRYTAEDLYRPHPGFYRPRLSNCSDYSGQFLHPDA
WARGRSPSDISSEASLQMNSSYPALLKCPDYDQMSSSPC
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggcgatgagcgcctgcagcaggaaggcgctgaccctgctcagcagcgtgttc
gccgtctgcggcctcggcctcctgggcatctccgtcagcaccgactactggctctacctg
gaggagggcatcgtccagccccaaaaccagacggccgagatcaagctctcgctgcactcg
gggctctggagggtctgctttctggcaggtgaggagcgtggccggtgcttcaccatcgaa
tacgtcatgcccatgaacatccagctgacctctgaatccacaatcaacgtcctaaagatg
atccgctctgccacccccttccctctggtcagcctcttcttcatgttcatcggcttcatc
ctgagcaacatcggccacatccggcctcacaggaccatcctggccttcgtctcggggata
ttcttcatcctctcaggtctgtcactggtggtggggctggtcctctacatatccagcatt
aacgacgaaatgctcaacaggaccaaggactcggagtcattcttcaattacaaatatggg
tggtcctttgccttctctgccatctcattccttctcacagagagcgccggggtgatgtcc
gtgtacctgttcatgaagcgctacacggccgaggacctctacagaccccaccccggcttc
taccggccccgcctgagcaactgctccgactactcggggcagttcctgcaccccgacgcg
tgggcgcggggccgcagcccctcggacatctccagcgaggcgtccctgcagatgaacagc
agctacccagccctgctcaagtgccctgactacgaccagatgtcctcgtccccgtgctga

DBGET integrated database retrieval system