KEGG   Serinus canaria (common canary): 103819925Help
Entry
103819925         CDS       T05755                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2 isoform X1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00260  Glycine, serine and threonine metabolism
scan01100  Metabolic pathways
scan01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103819925
Enzymes [BR:scan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     103819925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 103819925
NCBI-ProteinID: XP_030088887
Position
Unknown
AA seq 357 aa AA seqDB search
MRRAMARAAVGDDDYGEDPAVNELPAPGRGDSGDGIGSVRAHGHHGQPHRWGAQLFLGQD
AHLHVYEHGGAAQVAGVHSQALPDLPNGTFDLEQLELTIREAHGSQYHPRPELICLENTH
SSAGGRALPLTYLRQVRGLADNYGLRVHMDGARLMNAAVAQGVEPAQIAQHCDSVSLCFS
KGLGAPAGAVLAGCRQFVAEAWRVRKLLGGGMRQAGVLAAAAHLGLQHAEATLRRDHDHA
RRFAEGIHALDSPVCSVSLAAVETNIVMVNVQGAWPSPAELCDRLRAVSEEEEAETGQAV
SVLLFPWSARTVRAVWHRDISARDTELARRKLEFVARKCQEELALGLHPAPPGTGGA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgggccatggcccgcgccgccgtgggcgacgacgactacggggaggacccggcg
gtgaacgagctgccagcgccgggccgcggcgactctggggacggaatcggctctgttcgt
gcccacggccaccatggccaacctcatcgctggggcgctcagctgttcctgggccaggac
gcccacctgcacgtctacgagcacggcggggccgcgcaggtcgccggtgtgcactcccaa
gctctgcccgatctgccgaatggcacattcgacctggagcagctggagctgaccatccgt
gaggcccacggcagccagtaccacccgcgtcctgagctcatctgtctggagaacacgcac
agctcggcgggcggccgggcactgcccctcacctatctcaggcaggtccgtgggcttgca
gacaattatgggctgcgggtgcacatggacggcgcacgactgatgaatgcagcagtggcc
cagggtgtggagccagctcagattgcccagcactgtgactctgtgtccctctgcttctcc
aagggtctgggcgccccggcgggcgcggtgctggcggggtgcaggcagtttgtggccgag
gcctggcgtgtgaggaagctactgggcgggggcatgcggcaggcgggagtgctggcggcg
gccgcccacctcgggctgcagcacgccgaggccacgctgcgcagggaccacgaccacgcc
cggcgctttgcggaaggtatccacgcgctggactctcctgtctgctccgtcagcctggca
gcagtggagaccaacattgtgatggtgaatgtccagggggcctggccgtcccctgccgag
ctctgcgaccgcctgcgtgccgtcagtgaggaggaggaggctgagaccgggcaggctgtc
agcgtcctgctgttcccctggtcggcacggaccgtgcgcgccgtctggcaccgcgacatc
tcggcccgagacaccgagctcgccaggagaaagctggaatttgtggccaggaagtgccag
gaggaattggccttgggactgcatccagcgcctccaggcacggggggagcctga

DBGET integrated database retrieval system