KEGG   Serinus canaria (common canary): 103819970Help
Entry
103819970         CDS       T05755                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
scan  Serinus canaria (common canary)
Pathway
scan04270  Vascular smooth muscle contraction
scan04371  Apelin signaling pathway
scan04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103819970 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103819970 (GNA13)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103819970 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scan04147]
    103819970 (GNA13)
   04031 GTP-binding proteins [BR:scan04031]
    103819970 (GNA13)
Exosome [BR:scan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103819970 (GNA13)
  Exosomal proteins of colorectal cancer cells
   103819970 (GNA13)
GTP-binding proteins [BR:scan04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    103819970 (GNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 103819970
NCBI-ProteinID: XP_018774321
Position
Unknown
AA seq 379 aa AA seqDB search
MLAVAVAVRSGARSGPGPAHLAADTATRRGRRHRRAPQPISTRRPALICMKAGATAWGRS
WEALCRVGALFLCADPWAGETGDAEKLLTVPFLVIAGVRVLVDAREKLHIPWGDPANQSN
GDKVMAFDTRAVTVVQGMVETGVFLDYLPAIRALWADSGIQHAYDRRREFQLGESVKYFL
DNLDKLGEQDYLPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFD
SVTSILFLVSSSEFDQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEE
KVQKVSIKDYFPEFEGDPHCLTDVQKFLVDCFRTKRRDQQQKPLYHHFTTAINTENIRLV
FRDVKDTILHDNLKQLMLQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttggcggtggcggtggccgtgcggagcggagcgcggagcggccccggcccggcgcac
ctggctgcggacaccgccacccgccgggggcggcgccaccgccgcgcgccgcagccaatc
agcacccgccgtcccgccctcatttgcatgaaggcgggggcgaccgcttgggggcgctcg
tgggaggctttgtgcagagtaggtgcattgttcctctgtgcagatccgtgggctggtgaa
acaggagatgctgagaaactgctcacggtgcccttccttgtcattgcaggtgtgcgagtc
ctcgtggatgccagagagaagctgcacatcccttggggggatcctgccaaccagagcaac
ggtgacaaggtgatggctttcgacacgcgcgcggtcaccgtggtgcagggcatggtggag
accggcgtgtttttggactacctgcctgccatccgagccctgtgggcagacagtggcatc
cagcacgcctacgacaggcgcagggagttccagctgggggaatctgtaaagtatttcttg
gacaacttggataaacttggagaacaagattaccttccctcacagcaagatatcctgctg
gcacgaaggcccaccaaagggattcacgagtacgactttgaaatcaaaaacgtccctttc
aagatggtcgacgtgggtggccagaggtcggagcggaagcggtggttcgagtgcttcgac
agcgtcacatccattttgttcctcgtgtcctccagtgaatttgaccaagtgctcatggag
gaccggcagacgaatcgcctcacggagtccctgaacatttttgaaacgatagtcaacaac
cgggtgttcagcaacgtctccatcatcctcttcttaaacaagacggacttgcttgaggaa
aaagtacagaaagtcagcatcaaagactatttcccagagtttgaaggggatccccactgc
ttaacagatgtccaaaaattcctggtggattgttttcgcacaaaacgccgggaccagcag
cagaagcccctgtaccaccacttcaccactgctattaacacagagaacatccggctagtt
ttccgtgatgttaaggataccatcctgcacgacaacctcaagcagctgatgttacagtga

DBGET integrated database retrieval system