KEGG   Serinus canaria (common canary): 103820246Help
Entry
103820246         CDS       T05755                                 

Gene name
CAMKK1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 1 isoform X1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scan01001]
    103820246 (CAMKK1)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103820246 (CAMKK1)
Protein kinases [BR:scan01001]
 Serine/threonine kinases: Other
  CAMKK family
   103820246 (CAMKK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103820246
NCBI-ProteinID: XP_009093140
Position
Unknown
AA seq 532 aa AA seqDB search
MGDSPANVLDGGMDTQTELVERVAAIDVSVVPDRSDQNGEDNPEENDTVFSDSIKDIQRN
GVSSDVGINEFLPSQQSEDAHLRHVPKRPLTRPGLSSRKLSLQERSSGGYLASSSTPGCG
PYATGPSPRIIRRPTIESHRVSISDSEDCVQLNQYKLQSEIGKGSYGVVKLAYNENDDKY
YAMKVLSKKKLLKQYGFPRRPPPRGSKASSGEQPKPMAPLDRVYQEIAILKKLDHINIVK
LIEVLDDPAEDNLYMVFDLMRKGPVMEVPSEQPFSEEQARLYFRDIVLGIEYLHYQKIIH
RDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISQTGKSFSGKA
LDVWAMGITLYCFVYGKCPFIDEYILGLHNRIKTKPVEFPEEAQISDELKELILRMLDKN
PETRITVPEIKVHPWLSRGGAEPLPLEEEHCSVVEVTEEEVKNSVKTIPSLPAVILVKAM
LRKRSFGNPFEVQTRREERSMSAPGNLLITQGSREAARDPELPDVCEDEAAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgggggactctccagcaaatgtcctggatggaggcatggacacacagactgaactggtg
gagagggtggcagccatagacgtgtctgttgtcccagacagaagtgaccaaaatggtgaa
gacaaccctgaagaaaatgacacagtcttttctgatagcataaaggacatccagagaaat
ggagtcagcagtgacgtgggaatcaatgaatttctgccttcccaacagtcagaagatgct
cacttgaggcacgttcccaagagacctctcaccagacctggtctatccagtaggaagctg
tcccttcaggaaagatcctcaggaggttatttggcttccagcagcactccaggctgtggc
ccttatgccacagggccatccccacggataatcaggagaccaaccatagagtcccatcgg
gtctccatctcagactctgaggactgtgtgcaattaaaccagtacaagctgcagagtgaa
ataggcaagggctcctacggcgtggtgaagctggcctacaacgagaacgatgacaagtac
tatgctatgaaagtcctctccaaaaagaagctcttgaagcagtatggatttccacgtcgg
cctcctcccagagggtccaaagcatcctctggagagcagcccaagcccatggcacccctg
gacagagtctatcaggaaatagccatcctaaagaagctggatcacatcaatattgttaag
ctgatagaggtccttgatgatcctgcagaggacaacttgtacatggtgtttgacctcatg
aggaaagggcctgtcatggaggtgcccagtgagcagcccttcagcgaggagcaggctcgg
ctctacttccgagacatcgtcctgggcatcgagtacttgcactaccagaagatcatccac
agggacatcaagccttccaacttgctcttaggagatgatggccacgtgaaaattgctgat
tttggtgtcagcaatcagtttgaagggaatgatgcccagctttccagcacagcagggaca
ccagccttcatggcaccagaggccatctcccagactggcaaaagtttcagtggaaaggct
ctggatgtgtgggccatgggaatcaccctgtactgctttgtttatgggaagtgccctttt
atagatgaatatattctgggtcttcataataggatcaagaccaagcctgtggagttccca
gaagaagcacagataagtgacgagctcaaggagctgatcctgcgcatgctggataaaaat
ccagaaaccaggataacagtccctgaaataaaggtgcacccctggctgagccggggcggc
gcggagccgctgccgctggaggaggagcactgctccgtggtggaggtcaccgaggaggag
gtcaagaactctgtgaagaccatccccagcctgccagctgtgatcctggtgaaggccatg
ctgaggaaacgctcctttgggaacccctttgaggtccagacgaggagggaggagagatcc
atgtctgctccagggaacctgctgataacgcagggcagcagagaagccgcccgggacccg
gagctgcccgacgtgtgcgaggacgaggccgcggcctga

DBGET integrated database retrieval system