KEGG   Serinus canaria (common canary): 103820487Help
Entry
103820487         CDS       T05755                                 

Gene name
PIK3C2G
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00562  Inositol phosphate metabolism
scan01100  Metabolic pathways
scan04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103820487 (PIK3C2G)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    103820487 (PIK3C2G)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     103820487 (PIK3C2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PX C2 PI3K_C2 DUF4135 PI3K_rbd
Motif
Other DBs
NCBI-GeneID: 103820487
NCBI-ProteinID: XP_018775377
Position
Unknown
AA seq 1473 aa AA seqDB search
MAHFGGVPLSLSELCAGQPGPQAPHPVCHSGSGGHIPLGFDRILDEVSNEFFFYGSSHPH
HHEEMFVPAELFSQHVPDQHLYSHPLVAHGELYPGSPVPHWQQGSVAPMVGFRPSSVPDC
RNFSVVDSQPYSQEREPHGRNSVNSVSNVERGNSNLEFQIGFDNLGVPSPAFLENYPFGQ
KVREESGNGEASVTNTSGRCSTGPLHPQGSGHTREAAAWSIQLIEADQGSNENTVGFCNA
VEKIRNAYPAFDLKTNTGKIWSITTRFPEHILGGTKFRLSIWTDFSPHPLLLTQHAGCIT
HDLIVEILSCTNQYPAREECLLSVCGADEFLQNNCTLGSHESLRKASTCIQLRLHRAAHL
EHSLARTCGDDQRRFCVSELLQDTCAWRLIWQNLVSAVINYRGQVEYLLQNENNVDHVIE
AAKAICSVLCSVETRDVTDAVWKLQALGRAQNSLQSVETPGKVLIEAAVTELSMAISRLI
HAYSSSFDANFQLASIPRSPLCADISLNSQLSFTVCAAHHIPEAWVTSYRVFTFSCLLTY
AGKTICQVKICKNTEVKRSFFFQAYWNEKVNFPLRIKALPRETMLTVKLLGVNSASRNTE
VLAWTCCPLYAKERLLRGTVLLSLAPCSILPTALITPGICSTETPTSATLQIDFPEADLE
FIKPEAEERRGDLVEPTQECLKHIARLAQRHSLLLLSEQQRRILWFYRYSCNEQNCSLPL
VLGSAPSWDRTTVSEMHALLRAWSFSHPLQALGLLTFSFPDQDIRRAAVQQIENVSNDEL
LEYLPQLVQVLKFEWSLESPLVKLLLSRSLQSIQVAHQLYWLLKNAQNEVHFRMWYKKLL
AALQFCAGQTLNNEFSKEEKLIRILEDIATKVKAASDPKRKEVLKVELSRLQQFFQEVKL
CRLPLNPALVVQGIEADSCSYFTSNAFPLKISFINAKASSGNINVIFKIGDDLRQDMLVL
QIIHLMDSIWLQEGLDMQMIIYRCLSTGRGQGLVQMVPDATTLAKIHRESGLIGPLKENT
IKKWFHHHHPLESSYQEAIRNFFYSCAGWCVVTFILGVCDRHSDNIMLTTAGHMFHIDFG
RFLGHAQMFGSIKRDRAPFIFTSEMEYFITEGGKNPQRFQEFVELCCRAYNIVRKHSQLL
LNLLEMMLHAGLPELSSIQDLKYVYDNLRPQDSDLQATSYFTRKIKESLECFPVKLNNLI
HTLVQMSVGSSAKPPAPESVPQEWMVLDTEGSIARATILGFSRKPDPVYLIQVVQTCNVV
TFVEKSFHQFSKLHSHLQKQFPSHALPEFPHSWHLPFTDLEHKRVKDLNLYLKQLLSGSR
KLANNELVLSFFLNWSKNTLAEHSSSLTLGPQPAGEKPGVQLVISHENTCLTIMLKHMRN
LHLPDGSAPSAHAEFYLLPDPGEVSRRKTRTAPKGSDPTYNELIVYDRVPELQGRVLKLV
VKSKGTFVGAVNIQLSSVQLNEEKWYPLGNSVI
NT seq 4422 nt NT seq  +upstreamnt  +downstreamnt
atggcccactttgggggggtgcccttgtcactcagtgagctctgtgcaggacagccaggg
ccccaggcccctcacccagtgtgccactctggctctggtggacacatccctctaggattt
gatcgaatccttgatgaagtcagcaatgaattttttttttatggttcatcccacccacat
catcatgaagaaatgtttgtcccagcagaacttttcagtcagcacgtgcctgaccagcat
ctttacagtcatcctctggttgctcatggagagctgtaccctggaagtccagtccctcac
tggcagcaaggctcagtggcaccaatggttggcttcagaccttcctcagtgcctgactgc
agaaacttctctgtggtggattcccagccctacagtcaggagagagagccccatggaagg
aatagtgtaaattcagtctctaatgtggaaaggggcaactcaaatctggagtttcagata
ggctttgacaatctgggtgttccaagtcctgctttcttagagaattatccatttggacaa
aaagtgagagaagaaagtggaaatggggaagcttctgtaaccaacacttctggaagatgc
agcacaggacctctccacccccagggctctggacataccagagaggctgcagcttggtct
atccagctgattgaagcagatcaaggaagtaatgaaaacacagttggtttctgcaatgca
gtggagaagatcagaaatgcctatcctgcttttgatttgaagacaaatactgggaaaatc
tggagtatcacaacaaggttcccagagcatatccttggtggaacaaaattcagactcagc
atttggacagatttttcaccacatcctctactccttacacagcacgctggctgtatcact
cacgacttaattgtggagatcctcagttgcacaaatcaatacccagcccgggaggaatgc
cttctgagtgtttgtggggctgatgaattcttacagaacaactgtactttgggaagccac
gaaagtctccgcaaggcgagcacctgcattcagcttcgcctgcaccgcgctgctcatctg
gagcacagcttggccaggacatgtggggatgaccaaagaaggttctgtgtgagtgagctg
ttacaagacacttgtgcctggagactgatttggcagaaccttgtctctgctgttatcaac
tacagaggtcaagtggaatatctgctgcaaaatgagaacaatgttgatcatgtgattgag
gcagctaaagccatctgcagtgtcctgtgttctgtggaaaccagagacgtcactgatgca
gtctggaaactccaagctttggggagagcacagaattctcttcaaagtgtggaaacacca
ggcaaagtgttgatagaggctgctgtgactgagctctccatggccatctctcgtctcatc
catgcctacagcagcagctttgatgcaaatttccagcttgccagcatccctaggagccct
ttatgtgcagacatcagcctgaattcccagctgagcttcactgtttgtgcagcccatcac
atcccagaagcctgggtgaccagctacagagttttcactttttcctgtttactgacttat
gctgggaagacaatatgtcaagtgaagatttgcaaaaacactgaagttaaaagatccttc
ttctttcaggcttactggaatgagaaggtcaacttccctctaagaataaaggctcttcca
agggagactatgctgacagtcaaactgctgggagtgaacagtgcctcgagaaatacagaa
gtgctggcttggacatgctgcccattgtatgcaaaagagaggctgctccgtggaaccgtg
ctgctcagcctggcaccgtgcagcatccttcccacagcactgatcaccccgggcatctgc
agcactgagacaccaacctcagccaccctgcagattgacttcccagaagctgatttggag
ttcattaaacccgaagctgaagaaagaagaggtgatcttgtagagccaacccaagagtgc
ctgaagcacattgccagacttgcacagagacactctctcttgctactctcagagcagcag
aggagaatcctgtggttttatcgctactcctgcaatgagcagaactgctcccttcccctg
gtgctgggcagtgcccccagctgggacagaaccactgtgtcagaaatgcatgccctgctc
agggcttggagcttttctcaccctctgcaggcacttgggctgctgactttcagttttcca
gatcaagatattcgcagggcagcagtccaacaaatagaaaatgtgtcaaatgatgaattg
ttggaatatctcccacagctggttcaggtgctcaagtttgagtggagtcttgaaagccct
ctggtgaaactcctgctgagtcgttctctgcagagcatccaagtagcccatcagctttac
tggctgctgaagaatgctcagaatgaagttcatttcagaatgtggtataagaaacttctg
gctgctctccagttctgtgctggacagaccctgaacaatgagttttctaaggaagaaaaa
ctcatcagaattctggaagacattgccacaaaagtgaaagctgccagtgatccaaaaaga
aaggaggtgttgaaggtggagctcagcagactgcagcagttcttccaggaggtgaagctc
tgccggctgcccctgaaccccgcgcttgttgtgcaaggcatagaggcagattcatgttct
tattttacatccaatgcctttcccttaaaaatctccttcatcaatgcaaaggcttcaagt
ggaaacatcaatgttatttttaagataggtgatgatctacgtcaagatatgttggttctg
caaattattcacctgatggacagcatttggctccaagagggactggatatgcaaatgatc
atttacaggtgtttatccacaggcagaggacaaggactggtgcagatggtgccagatgct
accacgctagcaaagatccacagggagtctgggctgataggaccactgaaagaaaacaca
attaaaaaatggtttcaccaccaccatcctctggaatcaagttaccaagaggccataagg
aatttcttttattcctgtgctggctggtgtgttgttaccttcatcctgggagtctgtgat
cgacacagtgacaacataatgctgacaacagctggacacatgttccacatagactttgga
agatttttgggtcatgcacagatgtttggaagcatcaaaagggacagagctcccttcatc
ttcacatcagagatggagtatttcataacagagggggggaaaaacccacagcgtttccag
gagtttgtggagctgtgttgtcgagcctataacatagtcaggaagcacagccagctgctt
ctgaacctgctggagatgatgctgcatgcaggattgcctgagctgagcagcatccaggat
ctgaaatatgtgtatgataacctccgtcctcaggactcagatctccaggccacaagctac
tttacaaggaaaataaaggaaagcttggagtgctttcctgttaaactcaacaacttgatc
cacacgctggtgcagatgtcagtggggagctctgcaaagcctccagctccagagagtgtc
ccccaggaatggatggtgctggacacagagggctcaattgcaagggccaccattctggga
ttcagcagaaagcctgaccctgtatacctcatccaggtggtgcagacctgcaacgtggtc
acctttgtggaaaaatcattccaccagttctcaaaacttcacagccatctccagaagcaa
ttcccatctcatgccctcccagagtttccccactcatggcatttacctttcacggacctt
gagcacaagagagtgaaggatttgaacctctatctgaagcagctattaagtggctccagg
aaactggctaataatgagcttgtactcagcttcttcctcaactggtccaaaaataccttg
gcagaacactcatcatctttgaccttaggtcctcagccagctggtgagaagcctggagta
caactggtcatatcccatgagaacacctgcctgaccataatgctgaaacacatgaggaac
cttcacctcccagatggctctgccccaagtgcacatgctgaattttatcttctgccagac
cctggggaggtcagtcgaaggaaaaccaggacagctccaaaaggctctgaccctacttac
aatgaacttattgtctatgacagagtcccagagctccaaggccgtgtcctgaagcttgtg
gtgaaaagcaaaggaacttttgtgggagctgtgaacattcagctgagcagtgtccagctc
aatgaagagaagtggtacccactgggaaacagtgtcatttaa

DBGET integrated database retrieval system