KEGG   Serinus canaria (common canary): 103820515Help
Entry
103820515         CDS       T05755                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK1 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scan01001]
    103820515
   01009 Protein phosphatases and associated proteins [BR:scan01009]
    103820515
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103820515
Protein kinases [BR:scan01001]
 Serine/threonine kinases: Other
  Wnk family
   103820515
Protein phosphatases and associated proteins [BR:scan01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103820515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 103820515
NCBI-ProteinID: XP_030093945
Position
Unknown
AA seq 2391 aa AA seqDB search
MSGDAAGSGPPSPRFLVPPPPPPKNGSSSDSSVGDKLGAAEHGASSAGGAGGGPGSGGRS
EEYRRRRHTMDKDSRGAAATEHRFFRRSVICDSNATALELPSLQPAAPSAPVSGGSAAPS
VFPPSGAGRTPYAPVTVAEADSRPPPPAPLPLEGQAAEEPPAAKDAAPLLPKEEEEGDEA
TALPPTSVAGSLSAASREFEERRTQQEDIEELETKAVGISPDGRFLKFDIEIGRGSFKTV
YKGLDTETTVEVAWCELQDRKLSKSERQRFKEEAGMLKGLQHPNIVRFYDSWESTVKGKK
CIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNI
FITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEM
ATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKGERYAIKDLLN
HAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPED
VAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQSVQEEQENVLQEEGSQKQQLEQ
QQPSSASHAGSKHPQSVTGTTPVPTASASVSTQVEPEEPEADQHQQLQFQQPSISVLSDG
TVDSGQGSSVYTESVSSQQAVSYGSQHEQSVSSTGVQGYPASVGQVQSQQHGGYQPPAAT
QVQGQPASSNAAVPSQPTQHTQQSAQQPASSQQPGQYQLQQPSVSASTTPAPTVSQTQTS
QIMPVPQAAAGTQLPVSQPVSIIQGEPQLPVAASSLPQPSVAPSVPIGSHFLPMGQALPT
SVVPQFPVSQLPVAAPHVTVAQPGFQSLPISMAAGMNQPLLTLATSAAAAAVPVGPSVVP
SQLPTLMQPLAQLPSQVLPQLLQPPVQAVGLPVSIGQAAEASLPAGDALYQSFPSRLTPQ
YPGDSNVAPSSAVASASIPSAVLSPPLPTDAMAQSGYLAPVVQPYGEQNVLVSMGSLGGQ
AQVAQPPVSLPQQASSASSQQTVVEGTQGVSQTAASETLPATQPAQSTPLASSMDSAHSD
VASGLSDGNENVPTSSGRHEGRTTKRHMRRSVRSRSRHEKTSRPKLRILNVSNKGDRVVE
CQLETHNRKMVTFKFDLDGDNPEEIATIMVQNEFILATERDSFVEQVREIIEKADEMLSE
DASVEPEGDQGLESMRTKDDGFFPGSQKLEFKQPDPTSSMPQRIGVPSSSFTQVVHSAGR
RFIVSPVPENRLKEQGFFTSAVLGGNETSEMVAASPVHGPGMNLSHSASSLSLQQAFSEM
GHAQMTEGPSTAPPVFNQTIPPFPPALSTMAGSGATPASVATSSVSVSSSTGVSLPGSVT
LPSENAAVGVAPSTSVPSSISPPPASQSGQQSTGVTSSVSAPASFSLSATSQPALPVTAD
IAASISTPSSSALPPAQVPGVTALSAAAPAVTSQSTPQTVSSMAAAQTSVALSLAQNVAL
QLPQLSSSGSVSSLAETTVVSAPQSLPESGHSLDKSHSCSAAGLSLPISAPLSSSIASSI
CGSVSQPVIHPLLVPSGMTSTPVLPQISGATPMLPQVPLPGVLPQPVTNLPAVQQTLIHS
QPQPAPLPNQPHVHCLESDADAQSKAPGIDDIKTLEEKLRSLFSEHSNVGAVHPSVSLET
SLVMETTVVPGIPTTAVAPSKPLTSISTCIPPSSLPLGPTGLPVLTPVATPGQVITPVSY
ISASSSVASAAVKAGTSPSKPPLSRVPVLPVGSDLPAGTPSSEQLPPFPGPSLTQSQQPL
EDLDAQLRRTLSPETVPVTSAPACSVPSVASTVVTGPVSTATQSLKDVLAAGDGDNSAVG
AAGGASVLKMGRFQVSVAVDDVLKEGDKPETKPGQFETTSTDSSSLSGSSPESTLVKQAG
KSGAVAAPPLDVVDGVPEAAPALPLLADAAQATKVGRFQVTTTTDQVGRFSVSKARDEVS
CAEKEPMTLPLSVGLEQVASSAAAPKKELESRQSPQMNGPSSDPEVAFLSGMAKDLDDGS
GSPDSVQHLGSKISLPVQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLREKHLKEIQEL
QSRQKQEIESLYVKLGKAPPAVIIPPAAPLSGRRRRPTKGKGSKSSRSSSQGHKSPQLSG
NLSAQSAPSVLPPQQTLHPPGSVPETGQNHLLQPLKPSPSSENLYSAFTSDGALSVPSLS
APGQGTSSTNTVGAAVNSQAPPSQPTAIASSRKGTFTDDLHKLVDNWARDAMNLSGKKVG
KGHSNYEGPGMARKFSAPGQLCISMTSSLGATPIPAASATSLGPFSKAMCPPQQYGYPAA
SFPPPWSGPGAPAPPQLGQFQPVGATSLQSFNISNLQKSVSNPPGSNLRTT
NT seq 7176 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggacgccgccggcagcggccccccgagcccgcgcttcctggtgccgccgccg
ccgccgcccaagaacggttccagctcggacagctccgtcggagacaagctgggagccgcc
gagcacggagcctccagcgccggtggagcgggcggtggaccggggagcggaggccgcagt
gaggagtaccggcgccgccgccacaccatggacaaggacagccgaggggcggcagccacc
gagcaccgcttcttccgccggagcgtgatctgcgactccaacgccacggccttggagctg
cccagcttgcagcccgcagcgccctcggcccctgtctcgggaggcagcgcggctccctcg
gtgttccctccctcgggtgccggccggaccccttacgcccctgtcaccgtcgccgaggcc
gactcgcggccgccgccgcccgccccgctccccctggaaggacaggctgctgaggagccc
ccggccgccaaggatgccgccccgctgctgcccaaggaggaggaggagggggatgaggca
actgcgctaccccctaccagtgtcgctggcagcctgtcagctgccagccgggaatttgag
gagcggagaacacagcaggaagacatcgaagagcttgagaccaaggcagtgggcatctcc
ccggatggccgcttcctgaagtttgacatcgagattggaagaggctctttcaaaactgtg
tataaaggactggatactgaaaccactgtggaagttgcctggtgcgagctacaggatcgg
aagctgtccaagtcagagcgacaaagatttaaagaggaagctgggatgctgaaagggctt
cagcatcccaatattgtcagattctatgattcctgggagtctacagtcaaaggaaaaaag
tgtattgttcttgtgactgagctcatgacgtctggaacattaaaaacgtatttgaaaaga
tttaaagtgatgaaaattaaagttctacgaagctggtgccgtcagatactgaaaggttta
caatttctgcacacacgtactcctcccatcattcacagagacttaaaatgtgacaacatc
ttcattactggccccactggatcagtcaagattggagaccttggtctggcaaccctgaaa
cgagcttcctttgccaaaagtgtgataggtaccccagagttcatggcccccgagatgtat
gaggagaaatatgatgagtccgttgatgtttatgcttttgggatgtgtatgctagagatg
gccacgtctgaatatccttactccgagtgccaaaatgctgcgcagatctaccggcgagtg
accagtggtgtcaagccagccagctttgataaagtagcaatccctgaagtgaaggagatt
attgagggatgcattcggcaaaacaaaggtgaaagatatgctattaaggaccttttgaat
catgctttcttccaagaagagactggagtacgggtagaacttgcagaggaagatgatgga
gaaaaaattgccattaaactctggctccgaattgaagacatcaaaaaactcaagggcaaa
tataaagataatgaagcaatagagttttcatttgatttggaaagagatgtcccagaggat
gtggcacaggaaatggtggagtctggctatgtctgtgaaggggatcacaagaccatggcg
aaggctatcaaggacagggtatctttgattaagcgcaagcgagagcagcgccagtcggtg
caagaagaacaggagaatgtacttcaggaagaaggtagtcagaagcagcagctggagcag
cagcagccatcaagtgcttcccatgcagggtcaaagcatccccagtctgtcactggtact
actcctgtccctactgcttcagcgtcggtttctacacaagtggagcctgaagagccagaa
gctgatcagcaccaacagctgcagttccagcaacccagtatatctgttctttctgatgga
acagtggacagtggccaggggtcatctgtgtacactgaatctgtgagcagtcagcaggct
gtgtcctatggttcccagcatgagcagtcagtctcaagcactggagtccagggataccca
gcttcagttggccaagtgcagtcccagcagcatggaggttatcagccacctgcagcgaca
caggtgcaaggccagccagcctcaagcaatgctgcggtgccatcccagcctactcaacac
actcagcagagtgcacagcagccagcctcttcccaacagcctggacaataccagctgcag
cagccctcagtttctgccagcaccactcctgcaccaaccgtctctcaaactcagacttca
cagatcatgccagtgcctcaggcagcagctgggacacagcttcctgtttcccaaccagtg
tcgatcatccaaggcgagcctcaattacctgttgcagcatcttctctccctcagccttca
gttgccccatcagtccccattggctctcattttctacccatgggacaggccttgccaact
tccgtggttccccagttcccagtgtctcagttgcctgtagcagctcctcatgtgacagtg
gctcagccaggtttccagtcgctgcccatttcaatggcagctggcatgaatcagccactg
ctcacgctggccacatctgctgcagcagctgctgttcctgtaggaccaagcgttgtccct
agccagctccccacactgatgcagcctttggctcagctgcccagccaggttctcccgcag
ctcctgcagccgcctgtccaggccgtgggattgccagtcagcattggacaagctgctgaa
gcttcacttcctgctggagatgctctttaccagagcttcccatctcggctgacaccgcaa
tacccaggggactccaacgttgcaccttcctcagctgtggcctctgccagtattccttct
gctgtgctgtcccctcccttgcccacagatgcaatggcccagtcagggtaccttgctcct
gttgtgcagccgtatggggaacagaatgttctagtttccatgggcagcctgggaggacag
gctcaggtggcccagcctcctgtgagcttaccacaacaggcctcatctgcctcctcgcag
cagacagttgtggagggtactcagggagtctcacagactgctgcttcagagactcttcca
gcaacacagcctgctcagtctactcctttggcttcttctatggatagtgcacattctgat
gttgcttcaggattgagtgatggcaatgagaatgtcccaacttccagtggaaggcacgag
gggaggacaacgaaacgtcacatgcggagatctgtccgcagccgctcgcgccatgagaag
acttccaggccaaaactgaggattctaaatgtttccaacaaaggtgatcgggtagtggaa
tgccagctggagacacacaatcggaaaatggttactttcaaatttgatttggatggtgat
aatcctgaggaaatagctacaattatggtgcagaatgagtttattttagcaacagagcga
gactcatttgtagaacaggtacgagagataattgagaaagcagatgaaatgctaagtgag
gatgcaagcgtggagccagaaggggatcagggcttggagagcatgcggacaaaagatgac
ggcttcttcccggggtcacagaaattagagttcaaacagccagatcctacatcttccatg
ccacaaagaataggggttccctctagctcctttacccaggttgttcattctgctggaaga
cggttcattgtcagccccgtccctgagaaccgactgaaagaacagggctttttcacctct
gctgttcttggaggaaatgaaacttcagagatggttgcagcatctcctgtacatggtcct
ggaatgaatctctcccactcagcatcatcactgagcttgcagcaagctttctctgagatg
gggcatgctcagatgacagaaggacctagcacagctcctccagtgttcaatcaaacaata
ccaccatttccacctgcactttctaccatggcgggcagtggtgcaactcctgcatctgtg
gctacttcttcagtatctgtttcctccagcactggtgtttctcttccaggatctgttact
ttgccttcagaaaatgcagctgttggagttgcgccaagcacaagtgtgccaagctctatt
tctccacctcccgcctcacaatctggacagcaatcgaccggtgtcacttccagcgtgagc
gcccctgcttctttctccttatctgccacatcccagcctgctctaccagtgactgcagac
attgctgccagtatcagcacgccatcatcctcggcactgccacctgcccaggttcctggg
gtcactgctctcagtgctgctgcaccagctgtgacatctcagtctactcctcagactgtg
agtagtatggcagcagcacagacatctgttgccctgtctctggctcagaatgtggctttg
cagcttccccagctcagcagcagtggctctgtgtccagtctggcagaaacaacagtcgta
agtgctcctcagtcactacctgagagtgggcactctctggacaaatcgcattcctgcagt
gcagctggcttatctctgccaatctctgcacctttatcatcctcaatagcatcaagcata
tgtggttcagtctctcagccagtgatccatcccttacttgttccatcaggaatgacatca
acacctgtcctaccccagatttcaggtgcaacgcccatgttgccccaggttcccttacct
ggtgtcttgccacaaccagtcactaacttgcctgcagtacagcagactttgatccacagc
cagcctcaaccagctccattgcccaaccagcctcatgttcactgtctggagtctgatgct
gatgctcagtctaaagcccctggtattgatgatataaagaccctggaggaaaagctgcga
tctctcttcagtgagcacagtaatgtgggagcggtgcatccgtcagtgtctctggagacc
tctctggtgatggaaacaacagttgttcctggcatcccaaccactgctgttgcaccaagc
aaacccctgacatctattagcacttgtatacctccaagcagtttgcctcttggaccaact
ggcttgccagtactgactccagttgccactcctgggcaagtgatcaccccggtcagctac
atctctgcctcgagcagcgtggcctcagcagcagtgaaagcagggacctctccttccaag
ccccctctcagcagggtaccggtgctaccagtaggttctgaccttccggctggcactcca
tccagtgagcagctgccaccttttccaggaccttcactaactcagtcccaacagccactg
gaagatctggatgctcagctgagaagaacccttagtccagagaccgtcccagtgacatct
gctcctgcctgttctgtgccctcagtggcatcaacagtggttactgggccggtgtccaca
gcaacacagagtctgaaggatgttttggcagcaggtgatggagacaacagtgctgtgggt
gctgcaggaggagccagtgtgctgaagatgggacggtttcaggtgtcggtggcagtggat
gatgtgctaaaagagggtgacaaacctgaaacgaagccagggcaatttgaaaccacctcc
actgattcttcaagcctttctggcagtagcccagagagcacgctggtgaagcaggctggg
aagagcggggctgtggctgccccccccttggatgtggtggatggtgttcccgaggcagct
cccgcgctgccgctgctggcagatgctgctcaggccaccaaggttgggcgcttccaggtg
accacaacgacggatcaagtggggcgcttctccgtgtcaaaggctcgggatgaggtcagc
tgtgctgagaaagagccaatgactcttcctctctctgtgggcttggaacaagttgcttct
tcagctgcagctccaaagaaagagttggagtcgaggcagtccccacaaatgaatggtcca
tcctctgatccggaggtcgcttttctcagtggcatggctaaggatttggatgatggctca
gggagcccagactctgtccagcacctgggatcaaagatcagcctccctgttcagagcctt
agcaactccttcaactcttcctacatgagcagtgacaatgagtcggatattgaagatgaa
gacttgaagttggaactccgtcggttgcgggagaagcaccttaaagagatccaggagctg
cagagccgccagaagcaggagattgagtcactctatgtgaagctgggcaaggctccacct
gcagtaattattcccccagctgcacccctgtcaggaagaaggagacgacctacgaaagga
aaaggcagcaagtccagtcgtagcagctcccagggacataaaagccctcagctatcaggc
aacctatcagctcaaagtgcaccatcagtcttgccccctcagcagacccttcatcctcct
ggcagtgtgccagagactgggcagaaccatttgttacagcccctcaaaccttcaccttcc
agtgaaaatctctactctgccttcaccagtgatggtgccctgtcggtaccgagcctttcg
gcgccaggccaagggaccagcagcaccaacacagtgggggctgcagtgaacagccaggct
cccccgagccagcccacggccatcgcctccagccgcaagggcaccttcaccgatgacctg
cacaaactggtggataactgggctcgggatgccatgaacctgtctggcaagaaagttggc
aaagggcacagcaactacgagggccctggaatggcaagaaaattctcggcaccaggtcag
ctctgtatctctatgacatcttccctgggtgctacacccatccctgcagcatcagctacc
tctttaggtcccttcagcaaggccatgtgccccccgcagcagtacggttacccagcagcg
tccttccccccgccctggagcgggccaggggcgccagcaccgccacagctcggccagttc
cagcccgtgggtgccacgtctttgcaaagcttcaacatcagcaatttgcaaaagtctgtc
agcaaccctccaggctccaacctgcggaccacttag

DBGET integrated database retrieval system