KEGG   Serinus canaria (common canary): 103821459Help
Entry
103821459         CDS       T05755                                 

Gene name
PPIC
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase C
  KO
K09563  peptidyl-prolyl isomerase C (cyclophilin C) [EC:5.2.1.8]
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:scan03110]
    103821459 (PPIC)
Enzymes [BR:scan01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103821459 (PPIC)
Chaperones and folding catalysts [BR:scan03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    103821459 (PPIC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 103821459
NCBI-ProteinID: XP_018776751
Position
Unknown
AA seq 197 aa AA seqDB search
MACLCFLAPVAEAFKRRGPSMTAQVFFDVKIGDKDVGRIIIGLFGKVVPKTVENFIALAT
GERGYGYKGSKFHRVIKDFMIQGGDFTAGDGSGGRSIYGERFPDENFKLKHYGIGWVSMA
NSGPDTNGSQFFISVTKPSWLDGKHVVFGKVLDGMSVVHSIELQQTDEHDRPLQDCVIVN
SGKIAVKEPFVVEVGDW
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtctgtgcttcctggcccccgtggccgaggccttcaagaggaggggacccagc
atgacagctcaggtgttctttgatgtgaagatcggggacaaagatgttggcagaattata
attggattatttggaaaagttgtcccaaagaccgtggagaacttcattgcgttggcaact
ggagaaagaggatatggatacaaaggaagtaaatttcatcgtgtgatcaaagacttcatg
attcaaggaggagactttacagctggagatggatcaggaggaagaagtatctatggagaa
aggtttcctgatgagaacttcaagctgaaacactatggaattggatgggttagcatggct
aattctggcccagacaccaacggatcccaattcttcatcagtgtgacaaagccttcctgg
ttagatggaaagcatgtagtatttggcaaagtccttgatggaatgtctgtggtgcactcg
atagaactccagcagacagatgaacatgatcggccccttcaggactgtgtgattgtgaac
agtggcaaaatagctgtaaaggaaccgtttgtagttgaagttggtgactggtga

DBGET integrated database retrieval system