KEGG   Serinus canaria (common canary): 103822721Help
Entry
103822721         CDS       T05755                                 

Definition
(RefSeq) cytosolic purine 5'-nucleotidase-like
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00230  Purine metabolism
scan00240  Pyrimidine metabolism
scan00760  Nicotinate and nicotinamide metabolism
scan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103822721
   00240 Pyrimidine metabolism
    103822721
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    103822721
Enzymes [BR:scan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     103822721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid
Motif
Other DBs
NCBI-GeneID: 103822721
NCBI-ProteinID: XP_018778175
Position
Unknown
AA seq 480 aa AA seqDB search
MDYTLAMYKSPDYEELAFALLLEHLVTIGYPPEILAYKYDPTFPTRGLVFDALYGNLLKV
DSHGNLLVCAHGFRFLKGAEILHYYPNKFIQRDDMKRFHILNTLFNLTEAHLYACLVDFF
TNCSRYVNCDTGYKHGNLFMSFRSMFQDVREAMDHVHLSGCLKEKTLENLEKYVVKDPRV
PLLLSRMKEVGKVFLATNSDYTYTDAIMSYLFDFSNEVKADVPRRPWRSYFDLIVVDTRK
PLFFAEGTVLRQVDTDTGKLRIGTYTGPLQHCAVYSGGSSDVVCDLLGVKGKDILYMGDH
IFGDILKSKKRQGWRTFLVVPELARELQVWTEKSELFEELRSLDLFLAELYQHLDSGSSE
RPDISSIKRRIQKVTHEMDMCYGKMGSLFRCGSRQTLFANQLMRYADLYAASFINFLYYP
FSYLFRAPPVLMAHESTVEHSHRDSGDASTALPPWLAQHGDPHPQVPQDSSEEEEDDGEA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggactacaccttggccatgtacaagtcgcctgactatgaggagctggccttcgctctg
ttgctggagcaccttgtcaccatcgggtaccctcctgagatccttgcctacaaatatgac
cccaccttccccacccgggggctggtgttcgatgccctgtacgggaacctgctgaaggtg
gattcccatgggaacctgctggtctgtgcccatggcttccgtttcctcaagggagccgaa
atcctccactattaccccaacaagttcatccagcgggatgacatgaaacgcttccacatc
ctcaacaccctcttcaacctcacagaggcccacctttatgcctgtctcgtggacttcttc
accaactgctccagatatgtcaactgtgacaccggctacaagcacgggaacctcttcatg
tcattccgcagcatgttccaggatgtgcgcgaggccatggaccatgtccacctctctggc
tgcctcaaggagaagacactggagaacctggagaaatacgtggtaaaggatccccgtgtg
ccactgctgctgagccgcatgaaggaggtggggaaggtcttcctggccaccaacagtgac
tacacctacactgatgccatcatgtcctacctgtttgacttcagcaatgaggtcaaggct
gacgtcccacggcggccctggaggtcctatttcgacctgattgtggtggacacccgcaag
cccctcttctttgctgagggcactgtcctgcgccaagtggacacggacacggggaagctg
cgcattgggacgtacactggccccctgcagcactgtgctgtgtactccggtggctcctca
gatgtggtgtgtgacctcctgggtgtgaagggcaaggacatcctctacatgggggaccac
atctttggggacatcctgaaatccaagaagcggcagggctggcgcaccttcctggtggta
cctgagctggcccgagagctgcaagtctggacagagaagagtgagctgtttgaggagctg
cggagcctggatctcttcctggccgagctgtaccagcacttggacagtggcagtagtgag
cgcccagacatcagctccatcaagcgtcggatccagaaagtcacacatgagatggacatg
tgctatgggaagatgggcagcctgttccgctgtggctcacgtcagacactctttgccaac
cagctgatgcgctatgcagacctctacgctgcctccttcatcaacttcctctattacccc
ttcagctacctcttccgggctccccctgtcctgatggcccatgagtcaacagtggagcac
tctcaccgggactcaggggacgccagcactgcccttcctccctggctggctcagcatggt
gatcctcacccgcaggtcccccaggactcaagcgaggaggaggaagatgatggagaagcc
tga

DBGET integrated database retrieval system