KEGG   Serinus canaria (common canary): 103823424
Entry
103823424         CDS       T05755                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00230  Purine metabolism
scan00240  Pyrimidine metabolism
scan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103823424 (DCK)
   00240 Pyrimidine metabolism
    103823424 (DCK)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103823424 (DCK)
SSDB
Motif
Pfam: dNK AAA_28 AAA_18 Thymidylate_kin AAA_33 DUF5066
Other DBs
NCBI-GeneID: 103823424
NCBI-ProteinID: XP_009096741
Position
Unknown
AA seq 257 aa
MATPPKRGRTDGRIKKVAVEGNIAAGKSTFVNILKQANEEWEVVPEPVARWCNVQQSSGD
DSEELSTSQRSGGNVLRMMYEKPERWAFTFQTYACLSRIRAQLGALDRKLGHAQNPVVFF
ERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWMNKQFGSRLALDGIIYLRATPEKCL
NRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFDYLQEIPILTLDVNEDFKGKK
DKYDHMIEKVKEFLSTL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagcgcggcaggaccgacggccgcatcaagaaggtcgccgtggag
ggcaacatcgctgcagggaaatccacctttgtgaatatcctgaaacaagccaatgaggag
tgggaagtggttcccgagccggtagctagatggtgcaatgtccagcaaagttctggagac
gactctgaggagctgagcacgtcgcagcggagcggcgggaacgtgctgcgcatgatgtac
gagaagccggagcgctgggccttcaccttccagacgtacgcgtgcctcagcaggatccgg
gctcagctcggcgccctggaccgcaagctgggccacgcccagaaccccgtcgtgttcttc
gagcgctccgtctacagcgacaggtacatctttgctgctaatttatacgagtctgactgc
atgaacgagaccgagtggacaatttaccaggactggcacgactggatgaacaaacagttt
ggctcgagactggcgctggatgggatcatttatctccgagccactcctgagaaatgcttg
aataggatttatttgcgtggaagagatgaagagcaagaaatccccattgaatatctggag
aagcttcactacaagcatgaaagttggctccagcacaggacactgcgaacagattttgac
tatctacaggaaattccaattttaacacttgatgtcaacgaagacttcaaaggcaaaaag
gacaaatacgatcacatgatcgaaaaggtcaaggaatttttgagcacattgtaa

DBGET integrated database retrieval system