KEGG   Serinus canaria (common canary): 103823885
Entry
103823885         CDS       T05755                                 

Gene name
ASIC1
Definition
(RefSeq) LOW QUALITY PROTEIN: acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:scan04040]
    103823885 (ASIC1)
Ion channels [BR:scan04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   103823885 (ASIC1)
SSDB
Motif
Pfam: ASC DUF4074
Other DBs
NCBI-GeneID: 103823885
NCBI-ProteinID: XP_030087486
Position
Unknown
AA seq 541 aa
MMDLKVDEEEVDSGQPVSIQAFASSSTLHGLSHIFSYERLSLKRVVWALCFLGSLALLAL
VCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDIQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQC
TPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDET
SFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKAVAGDSEF
XTTPXXXXXXXSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECAD
PALDFLVEKDNEYCICEMPCNMTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILV
LDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCR
RGKCRKNHKRNNTDKGVALSMDDVKRHNPCESIRGHPAGMTYAANILPHHPARGTFEDFT
C
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgatggacctgaaagtggacgaggaggaggtggacagtgggcagccggtgagcatccag
gccttcgccagcagctccaccctgcacgggctctcgcacatcttctcgtacgagcggctg
tcgctgaagcgcgtggtctgggcactttgcttcctgggctcgctggcgctgctcgccctc
gtctgcaccaaccgcatccagtactacttcctgtacccccacgtcaccaagctggacgag
gtggcggccaccaggctcaccttccccgctgtcaccttctgcaacctcaacgagtttcgg
ttcagccgagtgaccaagaatgacctgtaccacgccggcgagctcctggccttgctcaat
aacagatacgagatcccagacatccagacagccgatgagaagcagctggaaatcctgcag
gacaaggccaacttccgaaacttcaagcccaaacctttcaacatgctggagttttatgac
cgggctggccacgacatcagggagatgctgctgtcctgcttcttccgtggggagcagtgc
acccccgaagacttcaaagtggtcttcacccgctatgggaagtgctacaccttcaatgca
gggcaggacgggaagccccggctcatcaccatgaaggggggcactggcaacggcctggag
atcatgctggacatccagcaggacgagtacctgccagtgtggggggaaacagatgagacc
tcgtttgaagccgggatcaaggtgcaaatccacagccaggacgagccccctctgatcgac
cagctgggcttcggggtggctcccggcttccagacctttgtgtcctgccaggagcagcgg
ctcatctacctgccacctccctggggcgactgcaaggccgtggcgggcgactcagagttc
nntacgacaccnnnnnnnnnnnnnnnnnnnnactcagagttctacgacacctacagcatc
acggcgtgtcgcatcgactgcgagacccgctacctggtggagaactgcaactgccgcatg
gtgcacatgccaggcgatgccccttactgcaccccggagcagtacaaggagtgcgcggat
ccggccttagatttcctggtggagaaggacaatgagtactgcatctgtgagatgccctgc
aacatgacccgctacggcaaagagctctccatggtcaagatccccagcaaggcctcggcc
aagtacctggccaagaagtacaacaagtcagagcagtacatcggagagaacatcctggtg
ctggatatcttctttgaagccctgaactatgagacgatcgagcagaagaaggcgtacgag
gtggcgggtttgctgggtgacattggagggcagatggggctgttcattggggccagcatc
ctcacagtgctggagctgtttgactacgcctatgaggtgataaagcaccggctgtgccgg
cggggcaagtgccgcaagaaccacaagaggaacaacacagacaagggcgtcgcgctgagc
atggacgacgtgaagcgccacaatccctgtgaaagcatacgggggcacccagcaggcatg
acgtacgcagccaacatcctacctcaccacccggcccggggcacctttgaggacttcacc
tgctaa

DBGET integrated database retrieval system