KEGG   Serinus canaria (common canary): 103824442Help
Entry
103824442         CDS       T05755                                 

Gene name
HMGCS2
Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase, mitochondrial
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00072  Synthesis and degradation of ketone bodies
scan00280  Valine, leucine and isoleucine degradation
scan00650  Butanoate metabolism
scan00900  Terpenoid backbone biosynthesis
scan01100  Metabolic pathways
scan03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103824442 (HMGCS2)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    103824442 (HMGCS2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103824442 (HMGCS2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    103824442 (HMGCS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    103824442 (HMGCS2)
Enzymes [BR:scan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     103824442 (HMGCS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Abhydrolase_1 ACP_syn_III Phage_holin_7_1
Motif
Other DBs
NCBI-GeneID: 103824442
NCBI-ProteinID: XP_009097956
Position
Unknown
AA seq 518 aa AA seqDB search
MLRLVGRAVRCLGARWAPPGQERAPRGAWQPAAWQRACLSSAAGTGAWPKDVGILALEVY
FPAQYVDQEELERFDGVEAGKYTRGLGQKQMGFCAAHEDINSLCLTVVXXXXXXXLTVVQ
RLVERGRLSWDAIGRLEVGTETVIDKSKAVKTVLMQLFHDSGNTDVEGIDTTNACYGGTA
SLFNAAAWVESSAWDGRYAVVVCGDIAVYATGNARPTGGAGAIAMLVGPNAPLVLERGLR
GTHMEHAYDFYKPNLSSEYPVVDGQLSIQCYLRALDRCYAVYRRKAQTQWQQAGIQRPFT
LDDFKYIIFHSPFCKLVQKSVGRLLLNDFLASPNPDTASGLYKGLQSFRGVKLEDTYTSK
EVEKAFQAASQDIFNQKTKPSLLLSSRNGNMYTPSMYGCLASLLSQCSAQDLAGSRIGAF
SYGSGLAASMFSFRVSQDAAPGSPLDKLVSSLADLPTRLDARKRVAPQDFAEIMKRREET
HHLADHAPHGSQADLFPGTWYLTRVDSKYRREYARKPI
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcttggtcgggcgcgctgtgcgctgcttgggggcaaggtgggcaccgcctggg
caggagcgggcaccccggggcgcctggcaacccgcggcttggcagagggcatgcctctcc
agtgctgctgggacaggtgcctggcccaaggacgtgggcatcctggccctggaggtgtac
ttccctgcccagtacgtggatcaggaggagctggagcggtttgatggcgtggaggccggc
aagtacacacggggcctgggccagaagcagatgggcttctgcgctgcccacgaggacatc
aactccctgtgcctgaccgtggtnnnnnnnnnnnnnnnnnnnngcctgaccgtggtgcag
cggctggtggagcgcgggcgcctctcctgggacgccatcggccgcctggaggtgggcacc
gagaccgtcatcgacaagtccaaggccgtcaagaccgtcctcatgcaacttttccatgac
tctggcaacactgatgtggagggcatcgacaccaccaatgcctgctatgggggcacggcc
tcgctcttcaatgcggccgcctgggtggagtccagtgcctgggatggtcgctacgccgtg
gtggtgtgtggggacatcgctgtctacgccacagggaacgcacggcccacgggaggtgct
ggtgccatcgccatgctggtgggacccaacgccccgctggtgctggagagaggcctacgt
ggaacccacatggagcatgcctacgacttctacaagcccaatctgtcctctgagtacccg
gtggtggacgggcagctctccatccagtgctacctgcgggcgctggaccgctgctacgct
gtgtaccgacggaaggcacagacccagtggcagcaggctggcatccagaggcccttcacc
ctcgatgacttcaagtacatcatcttccactcgcccttttgcaagctggtgcagaagtcg
gtggggcggctgctgctgaacgacttcttggcctcccccaaccctgacacagcctccggc
ctctacaaggggctgcagtccttccgcggtgtgaagctggaggacacctacactagcaag
gaggtggagaaggcattccaggctgccagccaggacatcttcaaccagaagaccaagccc
tccctgctcctctcttcccgcaatggcaacatgtacacaccatccatgtatggctgcctg
gcctccctcctgtcccagtgctcagcacaggacctggccggctcccggattggtgccttc
tcctacggctcgggactggcggccagcatgttctccttccgtgtctcgcaggatgcagcc
ccaggctcgcccctggacaagctggtctccagcctggctgacctgcccactcgcctggac
gcccgcaagcgcgtggccccgcaggactttgccgagatcatgaagcgacgggaggaaacc
catcacttggctgaccacgcgccccacggctcccaggcggatctcttccccggaacctgg
tacctgacccgcgtggattccaagtaccgccgtgaatatgccaggaagcccatctag

DBGET integrated database retrieval system