KEGG   Serinus canaria (common canary): 103824692Help
Entry
103824692         CDS       T05755                                 

Gene name
HADHB
Definition
(RefSeq) trifunctional enzyme subunit beta, mitochondrial
  KO
K07509  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00062  Fatty acid elongation
scan00071  Fatty acid degradation
scan00280  Valine, leucine and isoleucine degradation
scan01100  Metabolic pathways
scan01212  Fatty acid metabolism
Module
scan_M00085  Fatty acid elongation in mitochondria
scan_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    103824692 (HADHB)
   00071 Fatty acid degradation
    103824692 (HADHB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103824692 (HADHB)
Enzymes [BR:scan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     103824692 (HADHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 103824692
NCBI-ProteinID: XP_009098239
Position
Unknown
AA seq 473 aa AA seqDB search
MSFMLSSALRNLPVSSAWAAGVFTRSLSCSSQFQSSAQTKTKKSLGKSGVKNVVVVEGVR
IPFLQSGTTYADLMPHDLARAALQGLLTRTSVPRDVVDYIVYGTVIQEVKTSNVAREAAL
GAGFSDKTPAHTVTMACISSNQAMTTGVGMIAAGQCDVVVAGGVELMSDVPIRHSRKMRK
TMLTLNRAKTLGQKLSLISKIRPDYFAPELPAVAEFSTSETMGHSADRLAAAFGISRLEQ
DEYALRSHTLAKRAQDEGLLQDVVSFKVPGKDTVTKDNGIRPSSLEQMGKLKPAFVKPYG
TVTAANSSFLTDGASAMLIMSEEKALAMGYKPKAYLRDFVYVSQDPKDQLLLGPTYATPK
VLEKAGLTLNDIDVFEFHEAFAGQILANLKAMDSDWFAQNYMGRKSKVGAPPLDKFNTWG
GSLSLGHPFGATGCRLVITAAHRLKKEGGQFGLVAACAAGGQGHAMIVELYPQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcatgctgagctctgccctgcggaacctccccgtgtcctcagcctgggctgct
ggggtctttactcgatcactcagctgctcctcgcagttccaatcttcagcccagacaaag
actaagaagagcttgggcaaaagtggggtgaagaatgtggtggtggtggagggtgtccgc
attcccttcctgcagtctggcaccacgtatgctgatctgatgccccatgacttagccaga
gcagcactgcagggcctgctgaccaggaccagtgtcccaagggatgttgttgattacatt
gtttatggcacagttatccaggaggtgaaaaccagcaatgttgccagagaggctgccttg
ggagcagggttctctgacaaaactccagcccacaccgtcaccatggcctgcatttcctca
aaccaggccatgaccacaggggtggggatgattgcagctggccagtgtgacgtggtggtg
gccggtggcgtggagctcatgtccgacgtccccatccgccacagcaggaagatgaggaag
accatgctgaccctgaacagagccaagaccctgggccagaagctctccctcatttccaaa
attcgccctgactactttgctcctgagctcccagctgtggcagagttctccaccagcgag
accatggggcactctgccgaccgcctggccgccgccttcggcatctcccgcctggagcag
gacgagtacgcgctgcgctcccacacgctggccaagagagcccaggacgaggggctgctg
caggatgtggtgtccttcaaagtgccaggcaaagacacagttaccaaagacaacgggatc
cgcccgtcctccctggagcagatgggaaaactgaagccagcctttgtcaagccctatgga
acagtgacagcagccaactcctccttcctgaccgacggagcgtcggcgatgctgatcatg
tctgaggagaaggccctggccatgggctacaaaccaaaggcctacctaagggatttcgtg
tacgtgtcccaggatcccaaggaccagctgctcctgggccccacctatgccacacccaaa
gtgctggagaaggccgggctcaccctgaatgacatcgatgtgtttgagttccacgaggcc
tttgctggccagatcctggctaacctgaaagccatggattcagattggtttgcacagaac
tacatgggcaggaagtcaaaggttggagcccctcccttggacaagttcaacacctggggg
ggctccctgtccctgggacacccctttggggccactggctgccgcctggtcatcactgct
gcccacaggctgaagaaggagggaggccagttcggcctggtggctgcctgtgctgcagga
gggcagggtcacgcgatgattgtggagctctacccccagtaa

DBGET integrated database retrieval system