KEGG   Serinus canaria (common canary): 103826100Help
Entry
103826100         CDS       T05755                                 

Gene name
SUCLG1
Definition
(RefSeq) LOW QUALITY PROTEIN: succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00020  Citrate cycle (TCA cycle)
scan00640  Propanoate metabolism
scan01100  Metabolic pathways
scan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103826100 (SUCLG1)
   00640 Propanoate metabolism
    103826100 (SUCLG1)
Enzymes [BR:scan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     103826100 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     103826100 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 103826100
NCBI-ProteinID: XP_030094908
Position
Unknown
AA seq 379 aa AA seqDB search
MATVAVLGKDLSVTPYYISPVIAFITHKDLSQFLLPVCSFPLQAHFQTVCHSPGSLECSP
QGLTGVQQNGVRHCSYTASRKNLYVNKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGIS
PGKGGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGI
PQQDMVGVKHRLLRQNKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTY
EAVHQTTQVGLGQSFCVGIGGDPFNGTNFIDCLDVFLKDPRTEGIILIGEIGGNAEEDAA
AFLKENNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAGVVVSM
SPAQLGSTIYKEFEKRKLL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagtggctgtgctgggaaaggacctgtcagtcactccctactacatcagccct
gtcattgctttcatcacccacaaagatctgagtcagtttttgttgcctgtttgttctttc
cccttgcaggcccattttcaaacagtctgccattctcctggaagcctggagtgttctccc
caaggcctcactggggttcaacagaatggagtccgacactgctcctacacagcatccagg
aaaaacctgtatgttaacaagaacacaaaggttatctgtcagggttttacaggcaaacag
ggcacctttcacagccagcaggcactggactatggcaccaatctagttggaggaatttct
ccagggaaagggggaaaaactcatctaggtctgcctgtgtttaattctgtgaaggaggcc
aaagaacaaacgggtgcttcagccactgtcatctacgtccctcccccgtttgctgctgct
gccatcaacgaggccatcgatgcagagatgcccctggtggtgtgcatcaccgagggcatc
ccccagcaggacatggtgggcgtcaaacaccggctgctgcggcagaacaagacccgcctg
gtgggccccaactgccctggggtcatcaatcctggagaatgtaaaattggtatcatgcct
ggtcacattcacaagaaaggaagaattggtattgtgtcaagatctggaaccctgacgtac
gaagctgttcatcagacaacacaagttgggttggggcagtctttttgtgttggtattgga
ggtgatcccttcaatggaactaattttattgactgccttgatgtcttcctgaaggatcct
cgtactgaggggatcatattgattggggagattggaggaaatgctgaagaagatgcagca
gcatttttgaaagaaaataattccggccccaatgccaagccagtggtgtccttcatagct
ggcctgacagctcctcctggccggcggatgggccacgccggagccatcattgctggggga
aaggggggagccaaggagaagattgcagccctccagagtgcaggggttgtggtcagcatg
tcccctgctcagctgggcagcaccatctacaaggagtttgagaaaaggaaattgctgtaa

DBGET integrated database retrieval system