KEGG   Serinus canaria (common canary): 103826372
Entry
103826372         CDS       T05755                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:scan01009]
    103826372 (AKAP5)
Protein phosphatases and associated proteins [BR:scan01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     103826372 (AKAP5)
SSDB
Motif
Pfam: Plasmodium_HRP
Other DBs
NCBI-GeneID: 103826372
NCBI-ProteinID: XP_030096291
Position
Unknown
AA seq 762 aa
MVKAAKEIEMENPREAETPSTGATCSPPEEQAKKPSMLCFKKRKKSCKKGLTVKDACEGA
SEEKSQCVSTDQEEAKASNASRSSKGTWAAIKNLARPQRRQKSSSRKKVPSDSQVQLEVD
AEESCAQDLPKKRASSGVKMPCVRFSRGKKKSSPSEAVEESEGSVQANEVMGVVNKASEE
PEDLAPTDKSESLSPVSAQQEQDKVKQEQHRMKEDQDTMKKDQATVKEDNHIAKESDTSA
GKSEPLTEPTRDAEENSECTVQLEITSSETFDETAQDKLQEGSLLPTTNDVEGREVAPEA
PASKDQPDNAPEITECQEIPGICKEMPERGELEKSINLSKECKAEETVTDFSELASGGDA
ASVQEAASVQDAVSVKDAVSVQEAANVQGATGVQEAESVQGATSVQEAESVQDAESVKDA
ANVQDAASMKDTVSVQDAMSVQDAASMKDAVSVQEAARVQDATNVQDAETAQETANVQGA
GSVKDVTSMKDAVSVPDATSVQDAVSVQETVSAQDVASMKDTASVKDAVSVKDPASLQDV
TSVQDTVSVQETVSAQDVASVEDAAGVQEAASVEDAAGVQEAVSVEDAAGVQEAVSVEDA
AGVQEAVSVEDAAGVQESVSVEDAAGVQEAASVQEYSSHQILEANTGAGVSIVITITEAE
DSDNTDSDQAYEPSPVLHQKKQKGNKKSNRNADVGQKEGPEAGGGPQAEEKGLGDQGHRT
GEQYELLLIETASSLVKAAIQSSIEQLVSEMALEQNKHNSFL
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggtgaaggcagccaaggaaattgaaatggagaacccaagagaggcagagactcccagc
acaggggccacatgctccccaccagaggaacaagcaaaaaagccctccatgctgtgcttt
aagaagcggaagaagtcctgtaagaaggggctgactgtgaaggatgcgtgcgaaggagcc
tcagaggagaaaagccaatgtgtcagcactgaccaagaggaggccaaagcttccaatgca
tcacgatcctccaaaggaacctgggcagccatcaaaaaccttgccaggcctcagagaagg
cagaagtcctcctcacggaagaaggtgccctctgattcccaagtgcagctggaggtggat
gctgaggagagctgtgcacaagacctcccaaagaaacgggcgagctctggggtgaagatg
ccctgtgtgaggttctccagaggtaagaaaaaatccagcccctcagaagcagtggaggag
tcagaaggcagtgttcaagcaaatgaagtgatgggtgttgtgaataaggctagtgaagag
ccagaggatttggccccgacagacaaatctgaatccctcagcccagtctctgcacagcag
gagcaggataaggtgaagcaggagcagcatagaatgaaggaggaccaggatacaatgaag
aaggaccaggctacagtgaaagaggacaaccatatagcaaaggaaagcgacacctctgct
gggaagagtgagcccttgacagagcccacacgtgatgcagaagaaaattcggagtgcact
gttcagttggagataaccagttcagagacatttgatgaaacagcccaggacaaactgcag
gaagggagtctgctcccaaccaccaacgatgtggagggcagggaagttgctcccgaagcg
cctgcttcaaaagatcaacctgacaatgcccctgaaatcacagagtgccaggaaatcccc
ggtatctgcaaagagatgcctgaaaggggtgaattggaaaagagcataaatctttctaag
gagtgcaaagccgaggagactgtaactgatttcagtgagttggcatctggaggggatgca
gcgagtgtgcaggaggcagcaagtgtgcaggatgcagtgagcgtgaaggatgcagtgagt
gtgcaagaggcagcaaatgtgcagggtgccacaggtgtgcaggaggcagagagtgtgcag
ggtgccacaagtgtgcaggaggcagagagtgtgcaggatgcagagagcgtgaaggatgca
gcaaatgtacaggatgcagcaagcatgaaggatacagtaagtgtgcaggatgccatgagt
gtgcaggatgcagcaagcatgaaggatgcagtgagtgtgcaggaggcagcaagagtgcag
gatgccacaaatgtgcaggatgcagagactgcacaggagacagcgaatgtgcagggtgca
ggaagtgtgaaggatgtaacaagcatgaaggatgcagtgagtgtgccagatgccacaagt
gtgcaggatgcagtgagtgtgcaggagacagtgagtgcccaggatgtagcaagcatgaag
gatacagcaagtgtgaaggatgcagtgagtgtgaaagatccagcaagcctgcaggatgtc
acaagtgtgcaggacacagtgagtgtgcaggagacagtgagtgcccaggatgtagcaagt
gtggaggatgcagcaggtgtgcaagaggcagcgagtgtggaggatgcagcaggtgtgcag
gaggcagtgagtgtggaggatgcagcaggtgtgcaggaggcagtgagtgtggaggatgca
gcaggtgtgcaggaggcagtgagtgtggaggatgcagcaggtgtgcaagagtcagtgagt
gtggaggatgcagcaggtgtgcaggaggcagcaagtgtgcaggaatactccagccatcaa
atactagaagcaaatacaggtgctggtgtcagcatcgtcatcaccatcactgaagctgag
gactctgacaacaccgactctgaccaggcctacgagccgtccccagttttgcaccaaaaa
aagcaaaaagggaataaaaaatcaaacaggaacgctgatgttggtcaaaaagagggcccc
gaggctggtggtggtccccaggcagaggagaaaggtctgggtgaccaggggcacagaact
ggggagcagtacgagttgctcctcatagaaaccgcctcctccctcgtgaaggcggccatt
cagtcatccatagagcagctggtcagcgaaatggcgctggaacagaataagcacaacagc
tttctgtga

DBGET integrated database retrieval system